SLC2A10 Antibody - middle region (ARP44048_T100)

• Product Number: ARP44048_T100
• Name: SLC2A10 Antibody - middle region (ARP44048_T100)
• Protein Size (# AA): 541 amino acids
• Molecular Weight: 60kDa
• NCBI Gene Id: 81031
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Solute carrier family 2 (facilitated glucose transporter), member 10
• Alias Symbols: ATS, ATORS, GLUT10
• Peptide Sequence: Synthetic peptide located within the following region: AKKTKPHPRSGDPSAPPRLALSSALPGPPLPARGHALLRWTALLCLMVFV
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Segade,F., (2005) Biochim. Biophys. Acta 1730 (2), 147-158
• Description of Target: SLC2A10 is a member of the facilitative glucose transporter family, which plays a significant role in maintaining glucose homeostasis.SLC2A10 is a member of the facilitative glucose transporter family, which plays a significant role in maintaining glucose homeostasis.[supplied by OMIM].
• Protein Interactions: UBC;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-SLC2A10 (ARP44048_T100) antibody is Catalog # AAP44048 (Previous Catalog # AAPP11789)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SLC2A10
• Uniprot ID: O95528
• Protein Name: Solute carrier family 2, facilitated glucose transporter member 10
• Protein Accession #: NP_110404
• Purification: Protein A purified
• Nucleotide Accession #: NM_030777
• Tested Species Reactivity: Human
• Gene Symbol: SLC2A10
• Predicted Species Reactivity: Human
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Human: 100%
• Image 1: Human Jurkat
  
  WB Suggested Anti-SLC2A10 Antibody Titration: 2.5ug/ml
  Positive Control: Jurkat cell lysate