Product Number |
ARP44014_T100 |
Product Page |
www.avivasysbio.com/slc7a14-antibody-n-terminal-region-arp44014-t100.html |
Name |
SLC7A14 Antibody - N-terminal region (ARP44014_T100) |
Protein Size (# AA) |
771 amino acids |
Molecular Weight |
85kDa |
NCBI Gene Id |
57709 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Solute carrier family 7 (orphan transporter), member 14 |
Alias Symbols |
PPP1R142 |
Peptide Sequence |
Synthetic peptide located within the following region: VAFFIGWNLILEYLIGTAAGASALSSMFDSLANHTISRWMADSVGTLNGL |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Ota,T., (2004) Nat. Genet. 36 (1), 40-45 |
Description of Target |
The function remains unknown. |
Protein Interactions |
PPP1CA; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Enhanced Validation |
Relative Expression (Western Blot) |
|
|
Datasheets/Manuals |
Printable datasheet for anti-SLC7A14 (ARP44014_T100) antibody |
Blocking Peptide |
For anti-SLC7A14 (ARP44014_T100) antibody is Catalog # AAP44014 (Previous Catalog # AAPP11755) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human SLC7A14 |
Uniprot ID |
Q8TBB6 |
Protein Name |
Probable cationic amino acid transporter |
Protein Accession # |
NP_066000 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_020949 |
Tested Species Reactivity |
Human |
Gene Symbol |
SLC7A14 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% |
Image 1 | Human kidney
| Human kidney |
| Image 2 |
| ARP44014-QC14157-42894-WB-image.jpg |
|
|