SLC7A14 Antibody - N-terminal region (ARP44014_T100)

Data Sheet
 
Product Number ARP44014_T100
Product Page www.avivasysbio.com/slc7a14-antibody-n-terminal-region-arp44014-t100.html
Name SLC7A14 Antibody - N-terminal region (ARP44014_T100)
Protein Size (# AA) 771 amino acids
Molecular Weight 85kDa
NCBI Gene Id 57709
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Solute carrier family 7 (orphan transporter), member 14
Alias Symbols PPP1R142
Peptide Sequence Synthetic peptide located within the following region: VAFFIGWNLILEYLIGTAAGASALSSMFDSLANHTISRWMADSVGTLNGL
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Ota,T., (2004) Nat. Genet. 36 (1), 40-45
Description of Target The function remains unknown.
Protein Interactions PPP1CA;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Enhanced Validation
Relative Expression (Western Blot) Avivasheild
Datasheets/Manuals Printable datasheet for anti-SLC7A14 (ARP44014_T100) antibody
Blocking Peptide For anti-SLC7A14 (ARP44014_T100) antibody is Catalog # AAP44014 (Previous Catalog # AAPP11755)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human SLC7A14
Uniprot ID Q8TBB6
Protein Name Probable cationic amino acid transporter
Protein Accession # NP_066000
Purification Protein A purified
Nucleotide Accession # NM_020949
Tested Species Reactivity Human
Gene Symbol SLC7A14
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Image 1
Human kidney
Human kidney
Image 2

ARP44014-QC14157-42894-WB-image.jpg
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com