SLC25A38 Antibody - middle region (ARP43978_P050)

• Product Number: ARP43978_P050
• Name: SLC25A38 Antibody - middle region (ARP43978_P050)
• Protein Size (# AA): 304 amino acids
• Molecular Weight: 34 kDa
• NCBI Gene Id: 54977
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Solute carrier family 25, member 38
• Alias Symbols: SIDBA2
• Peptide Sequence: Synthetic peptide located within the following region: VGIYFGTLYSLKQYFLRGHPPTALESVMLGVGSRSVAGVCMSPITVIKTR
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Strausberg,R.L., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903
• Description of Target: SLC25A38 is a members of the solute carrier family 25 (SLC25) which is known to transport molecules over the mitochondrial membrane.
• Protein Interactions: NOL12; ZSCAN16; EMG1; SLC25A38;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation:

  WB	Y
  SPR
  YCHAROS

• Blocking Peptide: For anti-SLC25A38 (ARP43978_P050) antibody is Catalog # AAP43978 (Previous Catalog # AAPP11719)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SLC25A38
• Uniprot ID: Q96DW6
• Protein Name: Solute carrier family 25 member 38
• Protein Accession #: NP_060345
• Purification: Affinity Purified
• Nucleotide Accession #: NM_017875
• Tested Species Reactivity: Human
• Gene Symbol: SLC25A38
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Sheep
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%
• Image 1: Human Muscle
  
  Human Muscle
• Image 2: Human Jurkat
  
  WB Suggested Anti-SLC25A38 Antibody Titration: 0.2-1 ug/ml
  Positive Control: Jurkat cell lysate