| Product Number |
ARP43966_P050 |
| Product Page |
www.avivasysbio.com/slc22a17-antibody-middle-region-arp43966-p050.html |
| Name |
SLC22A17 Antibody - middle region (ARP43966_P050) |
| Protein Size (# AA) |
538 amino acids |
| Molecular Weight |
58kDa |
| NCBI Gene Id |
51310 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Solute carrier family 22, member 17 |
| Alias Symbols |
BOCT, BOIT, 24p3R, NGALR, hBOIT, NGALR2, NGALR3 |
| Peptide Sequence |
Synthetic peptide located within the following region: HCYQPVGGGGSPSDFYLCSLLASGTAALACVFLGVTVDRFGRRGILLLSM |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Fang,W.K., (2007) Biochem. J. 403 (2), 297-303 |
| Description of Target |
The specific functin of this protein remains unknown. |
| Protein Interactions |
UBC; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-SLC22A17 (ARP43966_P050) antibody |
| Blocking Peptide |
For anti-SLC22A17 (ARP43966_P050) antibody is Catalog # AAP43966 (Previous Catalog # AAPP11707) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human SLC22A17 |
| Uniprot ID |
Q8WUG5 |
| Protein Name |
Solute carrier family 22 member 17 |
| Publications |
The level of nitric oxide regulates lipocalin-2 expression under inflammatory condition in RINm5F beta-cells. Biochem. Biophys. Res. Commun. 476, 7-14 (2016). 27233602 |
| Protein Accession # |
NP_065105 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_020372 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
SLC22A17 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100% |
| Image 1 | Human DU145
 | WB Suggested Anti-SLC22A17 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: DU145 cell lysate |
|
