| Product Number |
ARP43940_T100 |
| Product Page |
www.avivasysbio.com/slc5a4-antibody-n-terminal-region-arp43940-t100.html |
| Name |
SLC5A4 Antibody - N-terminal region (ARP43940_T100) |
| Protein Size (# AA) |
659 amino acids |
| Molecular Weight |
72kDa |
| NCBI Gene Id |
6527 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Solute carrier family 5 (low affinity glucose cotransporter), member 4 |
| Alias Symbols |
SAAT1, SGLT3, DJ90G24.4 |
| Peptide Sequence |
Synthetic peptide located within the following region: MASTVSPSTIAETPEPPPLSDHIRNAADISVIVIYFLVVMAVGLWAMLKT |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Li,M.S., (2003) Proc. Natl. Acad. Sci. U.S.A. 100 (20), 11753-11758 |
| Description of Target |
SLC5A4 belongs to the sodium:solute symporter family and is a sodium-dependent glucose transporter. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-SLC5A4 (ARP43940_T100) antibody |
| Blocking Peptide |
For anti-SLC5A4 (ARP43940_T100) antibody is Catalog # AAP43940 (Previous Catalog # AAPP25475) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human SLC5A4 |
| Uniprot ID |
Q9NY91 |
| Protein Name |
Low affinity sodium-glucose cotransporter |
| Protein Accession # |
NP_055042 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_014227 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
SLC5A4 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-SLC5A4 Antibody Titration: 1.25ug/ml
Positive Control: Jurkat cell lysate |
|
|
