Product Number |
ARP43938_T100 |
Product Page |
www.avivasysbio.com/slc43a3-antibody-n-terminal-region-arp43938-t100.html |
Name |
SLC43A3 Antibody - N-terminal region (ARP43938_T100) |
Protein Size (# AA) |
491 amino acids |
Molecular Weight |
54kDa |
NCBI Gene Id |
29015 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Solute carrier family 43, member 3 |
Alias Symbols |
EEG1, ENBT1, FOAP-13, PRO1659, SEEEG-1 |
Peptide Sequence |
Synthetic peptide located within the following region: MAGQGLPLHVATLLTGLLECLGFAGVLFGWPSLVFVFKNEDYFKDLCGPD |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Otsuki,T., (2005) DNA Res. 12 (2), 117-126 |
Description of Target |
SLC43A3 belongs to the SLC43A transporter family and is a putative transporter. |
Protein Interactions |
UBC; LAMC3; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-SLC43A3 (ARP43938_T100) antibody |
Blocking Peptide |
For anti-SLC43A3 (ARP43938_T100) antibody is Catalog # AAP43938 (Previous Catalog # AAPP25473) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human SLC43A3 |
Uniprot ID |
Q8NBI5 |
Protein Name |
Solute carrier family 43 member 3 |
Sample Type Confirmation |
SLC43A3 is strongly supported by BioGPS gene expression data to be expressed in Jurkat |
Protein Accession # |
NP_060081 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_017611 |
Tested Species Reactivity |
Human |
Gene Symbol |
SLC43A3 |
Predicted Species Reactivity |
Human, Dog, Horse, Rabbit |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Dog: 92%; Horse: 86%; Human: 100%; Rabbit: 92% |
Image 1 | Human Lung
| Human Lung |
|
Image 2 | Human Jurkat
| WB Suggested Anti-SLC43A3 Antibody Titration: 2.5ug/ml Positive Control: Jurkat cell lysateSLC43A3 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells |
|