SLC43A3 Antibody - N-terminal region (ARP43938_T100)

• Product Number: ARP43938_T100
• Name: SLC43A3 Antibody - N-terminal region (ARP43938_T100)
• Protein Size (# AA): 491 amino acids
• Molecular Weight: 54kDa
• NCBI Gene Id: 29015
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Solute carrier family 43, member 3
• Alias Symbols: EEG1, ENBT1, FOAP-13, PRO1659, SEEEG-1
• Peptide Sequence: Synthetic peptide located within the following region: MAGQGLPLHVATLLTGLLECLGFAGVLFGWPSLVFVFKNEDYFKDLCGPD
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Otsuki,T., (2005) DNA Res. 12 (2), 117-126
• Description of Target: SLC43A3 belongs to the SLC43A transporter family and is a putative transporter.
• Protein Interactions: UBC; LAMC3;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-SLC43A3 (ARP43938_T100) antibody is Catalog # AAP43938 (Previous Catalog # AAPP25473)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SLC43A3
• Uniprot ID: Q8NBI5
• Protein Name: Solute carrier family 43 member 3
• Sample Type Confirmation:

  SLC43A3 is strongly supported by BioGPS gene expression data to be expressed in Jurkat

• Protein Accession #: NP_060081
• Purification: Protein A purified
• Nucleotide Accession #: NM_017611
• Tested Species Reactivity: Human
• Gene Symbol: SLC43A3
• Predicted Species Reactivity: Human, Dog, Horse, Rabbit
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Dog: 92%; Horse: 86%; Human: 100%; Rabbit: 92%
• Image 1: Human Lung
  
  Human Lung
• Image 2: Human Jurkat
  
  WB Suggested Anti-SLC43A3 Antibody Titration: 2.5ug/ml
  Positive Control: Jurkat cell lysateSLC43A3 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells