SLCO1A2 Antibody - middle region (ARP43898_P050)

• Product Number: ARP43898_P050
• Name: SLCO1A2 Antibody - middle region (ARP43898_P050)
• Protein Size (# AA): 579 amino acids
• Molecular Weight: 64kDa
• NCBI Gene Id: 6579
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Solute carrier organic anion transporter family, member 1A2
• Alias Symbols: OATP, OATP-A, OATP1A2, SLC21A3
• Peptide Sequence: Synthetic peptide located within the following region: AIIGPLIGLLLASFCANVYVDTGFVNTDDLIITPTDTRWVGAWWFGFLIC
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Lee,W., (2005) J. Biol. Chem. 280 (10), 9610-9617
• Description of Target: SLCO1A2 is a sodium-independent transporter which mediates cellular uptake of organic ions in the liver. Its substrates include bile acids, bromosulphophthalein, and some steroidal compounds. The protein is a member of the SLC21A family of solute carriers.This gene encodes a sodium-independent transporter which mediates cellular uptake of organic ions in the liver. Its substrates include bile acids, bromosulphophthalein, and some steroidal compounds. The protein is a member of the SLC21A family of solute carriers. Alternate splicing of this gene results in three transcript variants encoding two different isoforms.
• Protein Interactions: PDZD3; SLC9A3R2; SLC9A3R1; PDZK1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-SLCO1A2 (ARP43898_P050) antibody is Catalog # AAP43898 (Previous Catalog # AAPP25434)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SLCO1A2
• Uniprot ID: P46721-2
• Protein Name: Solute carrier organic anion transporter family member 1A2
• Protein Accession #: NP_005066
• Purification: Affinity Purified
• Nucleotide Accession #: NM_005075
• Tested Species Reactivity: Human
• Gene Symbol: SLCO1A2
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Dog: 93%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%
• Image 1: Human Jurkat
  
  WB Suggested Anti-SLCO1A2 Antibody Titration: 0.2-1 ug/ml
  Positive Control: Jurkat cell lysate
• Image 2: Human Hela Whole Cell
  
  Host: Rabbit
  Target Name: SLCO1A2
  Sample Tissue: Human Hela Whole Cell
  Antibody Dilution: 1ug/ml