Product Number |
ARP43882_P050 |
Product Page |
www.avivasysbio.com/slc9a5-antibody-c-terminal-region-arp43882-p050.html |
Name |
Slc9a5 Antibody - C-terminal region (ARP43882_P050) |
Protein Size (# AA) |
898 amino acids |
Molecular Weight |
99kDa |
NCBI Gene Id |
277973 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Solute carrier family 9 (sodium/hydrogen exchanger), member 5 |
Alias Symbols |
Gm696 |
Peptide Sequence |
Synthetic peptide located within the following region: SFAFPPSLAKAGRSRSESSADIPQQELQPLMGHKDHTHLSPGTANSHWCI |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
The function of this protein remains unknown. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-Slc9a5 (ARP43882_P050) antibody |
Blocking Peptide |
For anti-Slc9a5 (ARP43882_P050) antibody is Catalog # AAP43882 (Previous Catalog # AAPP25419) |
Immunogen |
The immunogen is a synthetic peptide corresponding to a region of Mouse |
Uniprot ID |
B2RXE2 |
Protein Name |
Sodium/hydrogen exchanger RuleBase RU003722 |
Protein Accession # |
NP_001074801 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_001081332 |
Tested Species Reactivity |
Mouse |
Gene Symbol |
Slc9a5 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 93%; Horse: 86%; Human: 100%; Mouse: 86%; Pig: 86%; Rabbit: 93%; Rat: 93% |
Image 1 | Mouse Brain
| WB Suggested Anti-Slc9a5 Antibody Titration: 1.0 ug/ml Positive Control: Mouse Brain |
|
|