Product Number |
ARP43861_T100 |
Product Page |
www.avivasysbio.com/slc25a14-antibody-n-terminal-region-arp43861-t100.html |
Name |
SLC25A14 Antibody - N-terminal region (ARP43861_T100) |
Protein Size (# AA) |
198 amino acids |
Molecular Weight |
21kDa |
NCBI Gene Id |
9016 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Solute carrier family 25 (mitochondrial carrier, brain), member 14 |
Alias Symbols |
UCP5, BMCP1 |
Peptide Sequence |
Synthetic peptide located within the following region: SIVAEFGTFPVDLTKTRLQVQGQSIDARFKEIKYRGMFHALFRICKEEGV |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
Mitochondrial uncoupling proteins (UCP) are members of the larger family of mitochondrial anion carrier proteins (MACP). UCPs separate oxidative phosphorylation from ATP synthesis with energy dissipated as heat, also referred to as the mitochondrial proton leak. UCPs facilitate the transfer of anions from the inner to the outer mitochondrial membrane and the return transfer of protons from the outer to the inner mitochondrial membrane. They also reduce the mitochondrial membrane potential in mammalian cells. Tissue specificity occurs for the different UCPs and the exact methods of how UCPs transfer H+/OH- are not known. UCPs contain the three homologous protein domains of MACPs. SLC25A14 has an N-terminal hydrophobic domain that is not present in other UCPs. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-SLC25A14 (ARP43861_T100) antibody |
Blocking Peptide |
For anti-SLC25A14 (ARP43861_T100) antibody is Catalog # AAP43861 (Previous Catalog # AAPP26616) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human SLC25A14 |
Uniprot ID |
Q5JY88 |
Protein Name |
Brain mitochondrial carrier protein 1 Ensembl ENSP00000402578 |
Sample Type Confirmation |
SLC25A14 is supported by BioGPS gene expression data to be expressed in Jurkat |
Protein Accession # |
CAI42439 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_003951 |
Tested Species Reactivity |
Human |
Gene Symbol |
SLC25A14 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Yeast, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Yeast: 79%; Zebrafish: 100% |
Image 1 | Human Jurkat
| WB Suggested Anti-SLC25A14 Antibody Titration: 2.5ug/ml Positive Control: Jurkat cell lysateSLC25A14 is supported by BioGPS gene expression data to be expressed in Jurkat |
|
Image 2 | Human Jurkat Whole Cell
| Host: Rabbit Target Name: SLC25A14 Sample Tissue: Human Jurkat Whole Cell Antibody Dilution: 1ug/ml |
|