SLC25A14 Antibody - N-terminal region (ARP43861_T100)

Data Sheet
 
Product Number ARP43861_T100
Product Page www.avivasysbio.com/slc25a14-antibody-n-terminal-region-arp43861-t100.html
Name SLC25A14 Antibody - N-terminal region (ARP43861_T100)
Protein Size (# AA) 198 amino acids
Molecular Weight 21kDa
NCBI Gene Id 9016
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Solute carrier family 25 (mitochondrial carrier, brain), member 14
Alias Symbols UCP5, BMCP1
Peptide Sequence Synthetic peptide located within the following region: SIVAEFGTFPVDLTKTRLQVQGQSIDARFKEIKYRGMFHALFRICKEEGV
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target Mitochondrial uncoupling proteins (UCP) are members of the larger family of mitochondrial anion carrier proteins (MACP). UCPs separate oxidative phosphorylation from ATP synthesis with energy dissipated as heat, also referred to as the mitochondrial proton leak. UCPs facilitate the transfer of anions from the inner to the outer mitochondrial membrane and the return transfer of protons from the outer to the inner mitochondrial membrane. They also reduce the mitochondrial membrane potential in mammalian cells. Tissue specificity occurs for the different UCPs and the exact methods of how UCPs transfer H+/OH- are not known. UCPs contain the three homologous protein domains of MACPs. SLC25A14 has an N-terminal hydrophobic domain that is not present in other UCPs.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-SLC25A14 (ARP43861_T100) antibody
Blocking Peptide For anti-SLC25A14 (ARP43861_T100) antibody is Catalog # AAP43861 (Previous Catalog # AAPP26616)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human SLC25A14
Uniprot ID Q5JY88
Protein Name Brain mitochondrial carrier protein 1 Ensembl ENSP00000402578
Sample Type Confirmation

SLC25A14 is supported by BioGPS gene expression data to be expressed in Jurkat

Protein Accession # CAI42439
Purification Protein A purified
Nucleotide Accession # NM_003951
Tested Species Reactivity Human
Gene Symbol SLC25A14
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Yeast, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Yeast: 79%; Zebrafish: 100%
Image 1
Human Jurkat
WB Suggested Anti-SLC25A14 Antibody Titration: 2.5ug/ml
Positive Control: Jurkat cell lysateSLC25A14 is supported by BioGPS gene expression data to be expressed in Jurkat
Image 2
Human Jurkat Whole Cell
Host: Rabbit
Target Name: SLC25A14
Sample Tissue: Human Jurkat Whole Cell
Antibody Dilution: 1ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com