| Product Number |
ARP43845_P050 |
| Product Page |
www.avivasysbio.com/slc18a2-antibody-n-terminal-region-arp43845-p050.html |
| Name |
SLC18A2 Antibody - N-terminal region (ARP43845_P050) |
| Protein Size (# AA) |
514 amino acids |
| Molecular Weight |
56kDa |
| NCBI Gene Id |
6571 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Solute carrier family 18 (vesicular monoamine), member 2 |
| Alias Symbols |
SVAT, SVMT, VAT2, VMAT2, PKDYS2 |
| Peptide Sequence |
Synthetic peptide located within the following region: NATRDLTLHQTATQHMVTNASAVPSDCPSEDKDLLNENVQVGLLFASKAT |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Yamamoto,S., (2006) Neurosci. Lett. 396 (3), 187-191 |
| Description of Target |
The vesicular monoamine transporter acts to accumulate cytosolic monoamines into synaptic vesicles, using the proton gradient maintained across the synaptic vesicular membrane. Its proper function is essential to the correct activity of the monoaminergic systems that have been implicated in several human neuropsychiatric disorders. The transporter is a site of action of important drugs, including reserpine and tetrabenazine. |
| Protein Interactions |
PARK7; UBC; CSNK1A1; CSNK2A2; CSNK2A1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-SLC18A2 (ARP43845_P050) antibody |
| Blocking Peptide |
For anti-SLC18A2 (ARP43845_P050) antibody is Catalog # AAP43845 (Previous Catalog # AAPS14306) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human SLC18A2 |
| Uniprot ID |
Q05940 |
| Protein Name |
Synaptic vesicular amine transporter |
| Protein Accession # |
NP_003045 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_003054 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
SLC18A2 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 86%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 100%; Rat: 100% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-SLC18A2 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate |
|
| Image 2 | Human brain (cortex)
 | SLC18A2 (VMAT2) in human brain (cortex) was detected using HRP/DAB brown color stain |
|
