Product Number |
ARP43822_T100 |
Product Page |
www.avivasysbio.com/slc29a2-antibody-n-terminal-region-arp43822-t100.html |
Name |
SLC29A2 Antibody - N-terminal region (ARP43822_T100) |
Protein Size (# AA) |
456 amino acids |
Molecular Weight |
50kDa |
NCBI Gene Id |
3177 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Solute carrier family 29 (nucleoside transporters), member 2 |
Alias Symbols |
ENT2, DER12, HNP36 |
Peptide Sequence |
Synthetic peptide located within the following region: ARILSTNHTGPEDAFNFNNWVTLLSQLPLLLFTLLNSFLYQCVPETVRIL |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Owen,R.P., (2006) Drug Metab. Dispos. 34 (1), 12-15 |
Description of Target |
SLC29A2 mediates equilibrative transport of purine, pyrimidine nucleosides and the purine base hypoxanthine. It is less sensitive than SLC29A1 to inhibition by nitrobenzylthioinosine (NBMPR), dipyridamole, dilazep and draflazine. |
Protein Interactions |
UBQLN1; UBC; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-SLC29A2 (ARP43822_T100) antibody |
Additional Information |
IHC Information: Lane A: Marker. Lane B: HepG2 cell lysate. Antibody concentration: 2.5 ug/ml. Gel concentration: 12%. |
Blocking Peptide |
For anti-SLC29A2 (ARP43822_T100) antibody is Catalog # AAP43822 (Previous Catalog # AAPS14107) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human SLC29A2 |
Uniprot ID |
Q14542 |
Protein Name |
Equilibrative nucleoside transporter 2 |
Publications |
Okuda, H., Higashi, Y., Nishida, K., Fujimoto, S. & Nagasawa, K. Contribution of P2X7 receptors to adenosine uptake by cultured mouse astrocytes. Glia 58, 1757-65 (2010). 20645413 |
Protein Accession # |
NP_001523 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_001532 |
Tested Species Reactivity |
Human |
Gene Symbol |
SLC29A2 |
Predicted Species Reactivity |
Human, Rabbit |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Human: 100%; Rabbit: 91% |
Image 1 | Human kidney
| Human kidney |
| Image 2 | Human HepG2
| WB Suggested Antibody Titration: 2.5 ug/ml Positive Control: HepG2 |
|
|