| Product Number |
ARP43822_T100 |
| Product Page |
www.avivasysbio.com/slc29a2-antibody-n-terminal-region-arp43822-t100.html |
| Name |
SLC29A2 Antibody - N-terminal region (ARP43822_T100) |
| Protein Size (# AA) |
456 amino acids |
| Molecular Weight |
50kDa |
| NCBI Gene Id |
3177 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Solute carrier family 29 (nucleoside transporters), member 2 |
| Alias Symbols |
ENT2, DER12, HNP36 |
| Peptide Sequence |
Synthetic peptide located within the following region: ARILSTNHTGPEDAFNFNNWVTLLSQLPLLLFTLLNSFLYQCVPETVRIL |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Owen,R.P., (2006) Drug Metab. Dispos. 34 (1), 12-15 |
| Description of Target |
SLC29A2 mediates equilibrative transport of purine, pyrimidine nucleosides and the purine base hypoxanthine. It is less sensitive than SLC29A1 to inhibition by nitrobenzylthioinosine (NBMPR), dipyridamole, dilazep and draflazine. |
| Protein Interactions |
UBQLN1; UBC; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-SLC29A2 (ARP43822_T100) antibody |
| Additional Information |
IHC Information: Lane A: Marker. Lane B: HepG2 cell lysate. Antibody concentration: 2.5 ug/ml. Gel concentration: 12%. |
| Blocking Peptide |
For anti-SLC29A2 (ARP43822_T100) antibody is Catalog # AAP43822 (Previous Catalog # AAPS14107) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human SLC29A2 |
| Uniprot ID |
Q14542 |
| Protein Name |
Equilibrative nucleoside transporter 2 |
| Publications |
Okuda, H., Higashi, Y., Nishida, K., Fujimoto, S. & Nagasawa, K. Contribution of P2X7 receptors to adenosine uptake by cultured mouse astrocytes. Glia 58, 1757-65 (2010). 20645413 |
| Protein Accession # |
NP_001523 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_001532 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
SLC29A2 |
| Predicted Species Reactivity |
Human, Rabbit |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100%; Rabbit: 91% |
| Image 1 | Human kidney
 | Human kidney |
| | Image 2 | Human HepG2
 | WB Suggested Antibody Titration: 2.5 ug/ml
Positive Control: HepG2 |
|
|
