Product Number |
ARP43811_T100 |
Product Page |
www.avivasysbio.com/slc38a1-antibody-middle-region-arp43811-t100.html |
Name |
SLC38A1 Antibody - middle region (ARP43811_T100) |
Protein Size (# AA) |
487 amino acids |
Molecular Weight |
54 kDa |
NCBI Gene Id |
81539 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Solute carrier family 38, member 1 |
Alias Symbols |
ATA1, NAT2, SAT1, SNAT1 |
Peptide Sequence |
Synthetic peptide located within the following region: DRSQKKMQMVSNISFFAMFVMYFLTAIFGYLTFYDNVQSDLLHKYQSKDD |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Otsuki,T., (2005) DNA Res. 12 (2), 117-126 |
Description of Target |
Amino acid transporters play essential roles in the uptake of nutrients, production of energy, chemical metabolism, detoxification, and neurotransmitter cycling. SLC38A1 is an important transporter of glutamine, an intermediate in the detoxification of ammonia and the production of urea. Glutamine serves as a precursor for the synaptic transmitter, glutamate. |
Protein Interactions |
FATE1; UBC; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Enhanced Validation |
|
Datasheets/Manuals |
Printable datasheet for anti-SLC38A1 (ARP43811_T100) antibody |
Blocking Peptide |
For anti-SLC38A1 (ARP43811_T100) antibody is Catalog # AAP43811 (Previous Catalog # AAPS14008) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human SLC38A1 |
Uniprot ID |
Q9H2H9 |
Protein Name |
Sodium-coupled neutral amino acid transporter 1 |
Sample Type Confirmation |
SLC38A1 is supported by BioGPS gene expression data to be expressed in HepG2 |
Protein Accession # |
NP_001070952 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_001077484 |
Tested Species Reactivity |
Human |
Gene Symbol |
SLC38A1 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 85%; Rabbit: 93%; Rat: 93% |
Image 1 | Human kidney
| Human kidney |
| Image 2 | Human HepG2
| WB Suggested Anti-SLC38A1 Antibody Titration: 2.5ug/ml Positive Control: HepG2 cell lysateSLC38A1 is supported by BioGPS gene expression data to be expressed in HepG2 |
|
|