SLC38A1 Antibody - middle region (ARP43811_T100)

Data Sheet
 
Product Number ARP43811_T100
Product Page www.avivasysbio.com/slc38a1-antibody-middle-region-arp43811-t100.html
Name SLC38A1 Antibody - middle region (ARP43811_T100)
Protein Size (# AA) 487 amino acids
Molecular Weight 54 kDa
NCBI Gene Id 81539
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Solute carrier family 38, member 1
Alias Symbols ATA1, NAT2, SAT1, SNAT1
Peptide Sequence Synthetic peptide located within the following region: DRSQKKMQMVSNISFFAMFVMYFLTAIFGYLTFYDNVQSDLLHKYQSKDD
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Otsuki,T., (2005) DNA Res. 12 (2), 117-126
Description of Target Amino acid transporters play essential roles in the uptake of nutrients, production of energy, chemical metabolism, detoxification, and neurotransmitter cycling. SLC38A1 is an important transporter of glutamine, an intermediate in the detoxification of ammonia and the production of urea. Glutamine serves as a precursor for the synaptic transmitter, glutamate.
Protein Interactions FATE1; UBC;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Enhanced Validation
WBY
SPR
YCHAROS
Datasheets/Manuals Printable datasheet for anti-SLC38A1 (ARP43811_T100) antibody
Blocking Peptide For anti-SLC38A1 (ARP43811_T100) antibody is Catalog # AAP43811 (Previous Catalog # AAPS14008)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human SLC38A1
Uniprot ID Q9H2H9
Protein Name Sodium-coupled neutral amino acid transporter 1
Sample Type Confirmation

SLC38A1 is supported by BioGPS gene expression data to be expressed in HepG2

Protein Accession # NP_001070952
Purification Protein A purified
Nucleotide Accession # NM_001077484
Tested Species Reactivity Human
Gene Symbol SLC38A1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 85%; Rabbit: 93%; Rat: 93%
Image 1
Human kidney
Human kidney
Image 2
Human HepG2
WB Suggested Anti-SLC38A1 Antibody Titration: 2.5ug/ml
Positive Control: HepG2 cell lysateSLC38A1 is supported by BioGPS gene expression data to be expressed in HepG2
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com