SLC12A2 Antibody - C-terminal region (ARP43805_T100)

• Product Number: ARP43805_T100
• Name: SLC12A2 Antibody - C-terminal region (ARP43805_T100)
• Protein Size (# AA): 1212 amino acids
• Molecular Weight: 131kDa
• NCBI Gene Id: 6558
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Solute carrier family 12 (sodium/potassium/chloride transporters), member 2
• Alias Symbols: BSC, BSC2, KILQS, NKCC1, PPP1R141
• Peptide Sequence: Synthetic peptide located within the following region: IIAFEEIIEPYRLHEDDKEQDIADKMKEDEPWRITDNELELYKTKTYRQI
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Panet,R., (2006) J. Cell. Physiol. 206 (3), 578-585
• Description of Target: By moving chloride into epithelial cells, the Na-K-Cl cotransporter SLC12A2 aids transcellular movement of chloride across both secretory and absorptive epithelia.By moving chloride into epithelial cells, the Na-K-Cl cotransporter SLC12A2 aids transcellular movement of chloride across both secretory and absorptive epithelia (Payne et al., 1995). See also SLC12A1 (MIM 600839) and SLC12A3 (MIM 600968).[supplied by OMIM].
• Protein Interactions: EGFR; MDM2; ATP4A; COMMD1; UBC; SEC13; STK39; OXSR1; SLC12A2; MAPK14;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-SLC12A2 (ARP43805_T100) antibody is Catalog # AAP43805 (Previous Catalog # AAPP25393)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human SLC12A2
• Uniprot ID: P55011
• Protein Name: Solute carrier family 12 member 2
• Publications:

  Chen, N. et al. Quantitative proteome analysis of HCC cell lines with different metastatic potentials by SILAC. Proteomics 8, 5108-18 (2008). 19016532

  Jansen, L. A., Peugh, L. D., Roden, W. H. & Ojemann, J. G. Impaired maturation of cortical GABA(A) receptor expression in pediatric epilepsy. Epilepsia 51, 1456-67 (2010). 20132297

• Sample Type Confirmation:

  SLC12A2 is supported by BioGPS gene expression data to be expressed in DLD1

• Protein Accession #: NP_001037
• Purification: Protein A purified
• Nucleotide Accession #: NM_001046
• Tested Species Reactivity: Human
• Gene Symbol: SLC12A2
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 77%
• Image 1: Human Jurkat
  
  Host: Rabbit
  Target Name: SLC12A2
  Sample Tissue: Human Jurkat
  Antibody Dilution: 1.0ug/ml