| Product Number |
ARP43788_T100 |
| Product Page |
www.avivasysbio.com/slc25a29-antibody-c-terminal-region-arp43788-t100.html |
| Name |
SLC25A29 Antibody - C-terminal region (ARP43788_T100) |
| Protein Size (# AA) |
303 amino acids |
| Molecular Weight |
33kDa |
| NCBI Gene Id |
123096 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Solute carrier family 25 (mitochondrial carnitine/acylcarnitine carrier), member 29 |
| Alias Symbols |
CACL, ORNT3, C14orf69 |
| Peptide Sequence |
Synthetic peptide located within the following region: AEGWRVFTRGLASTLLRAFPVNAATFATVTVVLTYARGEEAGPEGEAVPA |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Sekoguchi,E., (2003) J. Biol. Chem. 278 (40), 38796-38802 |
| Description of Target |
SLC25A29 belongs to the mitochondrial carrier family and it may has palmitoylcarnitine transporting activity. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-SLC25A29 (ARP43788_T100) antibody |
| Blocking Peptide |
For anti-SLC25A29 (ARP43788_T100) antibody is Catalog # AAP43788 (Previous Catalog # AAPP25377) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human SLC25A29 |
| Uniprot ID |
Q8N8R3 |
| Protein Name |
Mitochondrial carnitine/acylcarnitine carrier protein CACL |
| Protein Accession # |
NP_001034444 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_001039355 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
SLC25A29 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-SLC25A29 Antibody Titration: 1.25ug/ml
Positive Control: Jurkat cell lysate |
|
|
