SLC45A2 Antibody - C-terminal region (ARP43780_P050)

• Product Number: ARP43780_P050
• Name: SLC45A2 Antibody - C-terminal region (ARP43780_P050)
• Protein Size (# AA): 460 amino acids
• Molecular Weight: 51kDa
• NCBI Gene Id: 51151
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Solute carrier family 45, member 2
• Alias Symbols: 1A1, AIM1, MATP, OCA4, SHEP5
• Peptide Sequence: Synthetic peptide located within the following region: IGWTAFLSNMLFFTDFMGQIVYRGDPYSAHNSTEFLIYERGVEVGCWGFC
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Hutton,S.M. (er) J. Invest. Dermatol. (2008) In press
• Description of Target: SLC45A2 is a melanocyte differentiation antigen that is expressed in a high percentage of melanoma cell lines. A similar sequence gene in medaka, 'B,' encodes a transporter that mediates melanin synthesis. Mutations in this gene are a cause of oculocutaneous albinism type 4.The protein encoded by this gene encodes a melanocyte differentiation antigen that is expressed in a high percentage of melanoma cell lines. A similar sequence gene in medaka, 'B,' encodes a transporter that mediates melanin synthesis. Mutations in this gene are a cause of oculocutaneous albinism type 4. Alternative splicing results in multiple transcript variants encoding different isoforms.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-SLC45A2 (ARP43780_P050) antibody is Catalog # AAP43780 (Previous Catalog # AAPP25369)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human SLC45A2
• Uniprot ID: Q6P2P0
• Protein Name: Membrane-associated transporter protein
• Protein Accession #: NP_001012527
• Purification: Affinity Purified
• Nucleotide Accession #: NM_001012509
• Tested Species Reactivity: Human
• Gene Symbol: SLC45A2
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Dog: 93%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 86%; Pig: 93%; Rabbit: 79%; Rat: 100%
• Image 1: Human Jurkat
  
  WB Suggested Anti-SLC45A2 Antibody Titration: 0.2-1 ug/ml
  Positive Control: Jurkat cell lysate
• Image 2: Human Fetal Lung
  
  Host: Rabbit
  Target Name: SLC45A2
  Sample Type: Human Fetal Lung
  Antibody Dilution: 1.0ug/ml
• Image 3: Human Fetal Liver
  
  Host: Rabbit
  Target Name: SLC45A2
  Sample Type: Human Fetal Liver
  Antibody Dilution: 1.0ug/ml
• Image 4: Human Adult Placenta
  
  Host: Rabbit
  Target Name: SLC45A2
  Sample Type: Human Adult Placenta
  Antibody Dilution: 1.0ug/ml