SLC10A5 Antibody - C-terminal region (ARP43773_T100)

Data Sheet
 
Product Number ARP43773_T100
Product Page www.avivasysbio.com/slc10a5-antibody-c-terminal-region-arp43773-t100.html
Name SLC10A5 Antibody - C-terminal region (ARP43773_T100)
Protein Size (# AA) 438 amino acids
Molecular Weight 48kDa
NCBI Gene Id 347051
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Solute carrier family 10 (sodium/bile acid cotransporter family), member 5
Alias Symbols P5
Peptide Sequence Synthetic peptide located within the following region: GYSFAKVCTLPLPVCKTVAIESGMLNSFLALAVIQLSFPQSKANLASVAP
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Ota,T., (2004) Nat. Genet. 36 (1), 40-45
Description of Target SLC10A5 is a new member of Solute Carrier Family 10 (SLC10) and the function remains unknown.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-SLC10A5 (ARP43773_T100) antibody
Blocking Peptide For anti-SLC10A5 (ARP43773_T100) antibody is Catalog # AAP43773 (Previous Catalog # AAPP25362)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human SLC10A5
Uniprot ID Q5PT55
Protein Name Sodium/bile acid cotransporter 5
Protein Accession # NP_001010893
Purification Protein A purified
Nucleotide Accession # NM_001010893
Tested Species Reactivity Human
Gene Symbol SLC10A5
Predicted Species Reactivity Human, Rat, Horse, Pig
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Horse: 86%; Human: 100%; Pig: 79%; Rat: 91%
Image 1
Human Jurkat
WB Suggested Anti-SLC10A5 Antibody Titration: 1.25ug/ml
Positive Control: Jurkat cell lysate
Image 2
Human Lung
Human Lung
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com