Product Number |
ARP43773_T100 |
Product Page |
www.avivasysbio.com/slc10a5-antibody-c-terminal-region-arp43773-t100.html |
Name |
SLC10A5 Antibody - C-terminal region (ARP43773_T100) |
Protein Size (# AA) |
438 amino acids |
Molecular Weight |
48kDa |
NCBI Gene Id |
347051 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Solute carrier family 10 (sodium/bile acid cotransporter family), member 5 |
Alias Symbols |
P5 |
Peptide Sequence |
Synthetic peptide located within the following region: GYSFAKVCTLPLPVCKTVAIESGMLNSFLALAVIQLSFPQSKANLASVAP |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Ota,T., (2004) Nat. Genet. 36 (1), 40-45 |
Description of Target |
SLC10A5 is a new member of Solute Carrier Family 10 (SLC10) and the function remains unknown. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-SLC10A5 (ARP43773_T100) antibody |
Blocking Peptide |
For anti-SLC10A5 (ARP43773_T100) antibody is Catalog # AAP43773 (Previous Catalog # AAPP25362) |
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human SLC10A5 |
Uniprot ID |
Q5PT55 |
Protein Name |
Sodium/bile acid cotransporter 5 |
Protein Accession # |
NP_001010893 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_001010893 |
Tested Species Reactivity |
Human |
Gene Symbol |
SLC10A5 |
Predicted Species Reactivity |
Human, Rat, Horse, Pig |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Horse: 86%; Human: 100%; Pig: 79%; Rat: 91% |
Image 1 | Human Jurkat
| WB Suggested Anti-SLC10A5 Antibody Titration: 1.25ug/ml Positive Control: Jurkat cell lysate |
| Image 2 | Human Lung
| Human Lung |
|
|