ABCD4 Antibody - C-terminal region (ARP43656_T100)

• Product Number: ARP43656_T100
• Name: ABCD4 Antibody - C-terminal region (ARP43656_T100)
• Protein Size (# AA): 497 amino acids
• Molecular Weight: 55kDa
• NCBI Gene Id: 5826
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: ATP-binding cassette, sub-family D (ALD), member 4
• Alias Symbols: P70R, P79R, ABC41, MAHCJ, PMP69, PXMP1L, EST352188
• Peptide Sequence: Synthetic peptide located within the following region: FGPHGVLFLPQKPFFTDGTLREQVIYPLKEVYPDSGSADDERILRFLELA
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: ABCD4 is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the ALD subfamily, which is involved in peroxisomal import of fatty acids and/or fatty acyl-CoAs in the organelle. All known peroxisomal ABC transporters are half transporters which require a partner half transporter molecule to form a functional homodimeric or heterodimeric transporter. The function of this peroxisomal membrane protein is unknown. However, it is speculated that it may function as a heterodimer for another peroxisomal ABC transporter and, therefore, may modify the adrenoleukodystrophy phenotype. It may also play a role in the process of peroxisome biogenesis.
• Protein Interactions: UBC; SARAF; PEA15; XRCC6; DLEU1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-ABCD4 (ARP43656_T100) antibody is Catalog # AAP43656 (Previous Catalog # AAPP11645)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human ABCD4
• Uniprot ID: O14678
• Protein Name: ATP-binding cassette sub-family D member 4
• Sample Type Confirmation:

  ABCD4 is supported by BioGPS gene expression data to be expressed in HepG2

• Protein Accession #: EAW81165
• Purification: Protein A purified
• Nucleotide Accession #: NM_005050
• Tested Species Reactivity: Human
• Gene Symbol: ABCD4
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 79%
• Image 1: Human HepG2
  
  WB Suggested Anti-ABCD4 Antibody Titration: 1.25ug/ml
  Positive Control: HepG2 cell lysateABCD4 is supported by BioGPS gene expression data to be expressed in HepG2