Product Number |
ARP43573_T100 |
Product Page |
www.avivasysbio.com/adh4-antibody-middle-region-arp43573-t100.html |
Name |
ADH4 Antibody - middle region (ARP43573_T100) |
Protein Size (# AA) |
380 amino acids |
Molecular Weight |
42kDa |
NCBI Gene Id |
127 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Alcohol dehydrogenase 4 (class II), pi polypeptide |
Alias Symbols |
ADH-2, HEL-S-4 |
Peptide Sequence |
Synthetic peptide located within the following region: NSEKFVKAKALGATDCLNPRDLHKPIQEVIIELTKGGVDFALDCAGGSET |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Luo,X., (2005) Pharmacogenet. Genomics 15 (11), 755-768 |
Description of Target |
ADH4, class II alcohol dehydrogenase 4 pi subunit, which is a member of the alcohol dehydrogenase family. Members of this enzyme family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. Class II alcohol dehydrogenase is a homodimer composed of 2 pi subunits. It exhibits a high activity for oxidation of long-chain aliphatic alcohols and aromatic alcohols and is less sensitive to pyrazole.This gene encodes class II alcohol dehydrogenase 4 pi subunit, which is a member of the alcohol dehydrogenase family. Members of this enzyme family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. Class II alcohol dehydrogenase is a homodimer composed of 2 pi subunits. It exhibits a high activity for oxidation of long-chain aliphatic alcohols and aromatic alcohols and is less sensitive to pyrazole. This gene is localized to chromosome 4 in the cluster of alcohol dehydrogenase genes. |
Protein Interactions |
UBC; RPL35; YWHAE; APP; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-ADH4 (ARP43573_T100) antibody |
Additional Information |
IHC Information: Fetal liver cell lysate. Antibody concentration: 1.25 ug/ml. Gel concentration: 12%. |
Blocking Peptide |
For anti-ADH4 (ARP43573_T100) antibody is Catalog # AAP43573 (Previous Catalog # AAPS13605) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human ADH4 |
Uniprot ID |
P08319 |
Protein Name |
Alcohol dehydrogenase 4 |
Publications |
Hu, Z. et al. Quantitative liver-specific protein fingerprint in blood: a signature for hepatotoxicity. Theranostics 4, 215-28 (2014). 24465277 |
Protein Accession # |
NP_000661 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_000670 |
Tested Species Reactivity |
Human |
Gene Symbol |
ADH4 |
Predicted Species Reactivity |
Human, Rat, Cow, Dog, Pig, Rabbit |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 86%; Human: 100%; Pig: 86%; Rabbit: 79%; Rat: 79% |
Image 1 | Human kidney
| Human kidney |
|
Image 2 | Human Fetal liver
| WB Suggested Anti-ADH4 Antibody Titration: 1.25ug/ml Positive Control: Fetal liver cell lysate |
|