ADH4 Antibody - middle region (ARP43573_T100)

• Product Number: ARP43573_T100
• Name: ADH4 Antibody - middle region (ARP43573_T100)
• Protein Size (# AA): 380 amino acids
• Molecular Weight: 42kDa
• NCBI Gene Id: 127
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Alcohol dehydrogenase 4 (class II), pi polypeptide
• Alias Symbols: ADH-2, HEL-S-4
• Peptide Sequence: Synthetic peptide located within the following region: NSEKFVKAKALGATDCLNPRDLHKPIQEVIIELTKGGVDFALDCAGGSET
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Luo,X., (2005) Pharmacogenet. Genomics 15 (11), 755-768
• Description of Target: ADH4, class II alcohol dehydrogenase 4 pi subunit, which is a member of the alcohol dehydrogenase family. Members of this enzyme family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. Class II alcohol dehydrogenase is a homodimer composed of 2 pi subunits. It exhibits a high activity for oxidation of long-chain aliphatic alcohols and aromatic alcohols and is less sensitive to pyrazole.This gene encodes class II alcohol dehydrogenase 4 pi subunit, which is a member of the alcohol dehydrogenase family. Members of this enzyme family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. Class II alcohol dehydrogenase is a homodimer composed of 2 pi subunits. It exhibits a high activity for oxidation of long-chain aliphatic alcohols and aromatic alcohols and is less sensitive to pyrazole. This gene is localized to chromosome 4 in the cluster of alcohol dehydrogenase genes.
• Protein Interactions: UBC; RPL35; YWHAE; APP;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Additional Information: IHC Information: Fetal liver cell lysate. Antibody concentration: 1.25 ug/ml. Gel concentration: 12%.
• Blocking Peptide: For anti-ADH4 (ARP43573_T100) antibody is Catalog # AAP43573 (Previous Catalog # AAPS13605)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ADH4
• Uniprot ID: P08319
• Protein Name: Alcohol dehydrogenase 4
• Publications:

  Hu, Z. et al. Quantitative liver-specific protein fingerprint in blood: a signature for hepatotoxicity. Theranostics 4, 215-28 (2014). 24465277

• Protein Accession #: NP_000661
• Purification: Protein A purified
• Nucleotide Accession #: NM_000670
• Tested Species Reactivity: Human
• Gene Symbol: ADH4
• Predicted Species Reactivity: Human, Rat, Cow, Dog, Pig, Rabbit
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Dog: 86%; Human: 100%; Pig: 86%; Rabbit: 79%; Rat: 79%
• Image 1: Human kidney
  
  Human kidney
• Image 2: Human Fetal liver
  
  WB Suggested Anti-ADH4 Antibody Titration: 1.25ug/ml
  Positive Control: Fetal liver cell lysate