| Product Number |
ARP43569_P050 |
| Product Page |
www.avivasysbio.com/gcdh-antibody-c-terminal-region-arp43569-p050.html |
| Name |
Gcdh Antibody - C-terminal region (ARP43569_P050) |
| Protein Size (# AA) |
447 amino acids |
| Molecular Weight |
49kDa |
| NCBI Gene Id |
364975 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Glutaryl-CoA dehydrogenase |
| Alias Symbols |
Gcdh |
| Peptide Sequence |
Synthetic peptide located within the following region: LQLGRLKDQDKATPEMVSLLKRNNCGKALDIARQARDILGGNGISDEYHV |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The function of this protein remains unknown. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Gcdh (ARP43569_P050) antibody |
| Blocking Peptide |
For anti-Gcdh (ARP43569_P050) antibody is Catalog # AAP43569 (Previous Catalog # AAPP25014) |
| Immunogen |
The immunogen is a synthetic peptide corresponding to a region of Rat |
| Uniprot ID |
D3ZT90 |
| Protein Name |
Glutaryl-Coenzyme A dehydrogenase (Predicted) EMBL EDL92192.1 |
| Protein Accession # |
NP_001102366 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001108896 |
| Tested Species Reactivity |
Rat |
| Gene Symbol |
Gcdh |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 93%; Guinea Pig: 85%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 86%; Rabbit: 92%; Rat: 93%; Zebrafish: 79% |
| Image 1 | Rat Brain
 | WB Suggested Anti-Gcdh Antibody
Titration: 1.0 ug/ml
Positive Control: Rat Brain |
|
|
