Product Number |
ARP43566_T100 |
Product Page |
www.avivasysbio.com/decr2-antibody-n-terminal-region-arp43566-t100.html |
Name |
DECR2 Antibody - N-terminal region (ARP43566_T100) |
Protein Size (# AA) |
292 amino acids |
Molecular Weight |
32kDa |
NCBI Gene Id |
26063 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
2,4-dienoyl CoA reductase 2, peroxisomal |
Alias Symbols |
PDCR, SDR17C1 |
Peptide Sequence |
Synthetic peptide located within the following region: MAQPPPDVEGDDCLPAYRHLFCPDLLRDKVAFITGGGSGIGFRIAEIFMR |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
De (2001) Biochim. Biophys. Acta 1533 (1), 66-72 |
Description of Target |
DECR2 is auxiliary enzyme of beta-oxidation. It participates in the degradation of unsaturated fatty enoyl-CoA esters having double bonds in both even- and odd-numbered positions in peroxisome. It catalyzes the NADP-dependent reduction of 2,4-dienoyl-CoA to yield trans-3-enoyl-CoA and has activity towards short and medium chain 2,4-dienoyl-CoAs, but also towards 2,4,7,10,13,16,19-docosaheptaenoyl-CoA, suggesting that it does not constitute a rate limiting step in the peroxisomal degradation of docosahexaenoic acid. |
Protein Interactions |
PEX5; EP300; UBC; APP; NEDD4L; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-DECR2 (ARP43566_T100) antibody |
Blocking Peptide |
For anti-DECR2 (ARP43566_T100) antibody is Catalog # AAP43566 (Previous Catalog # AAPP25011) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human DECR2 |
Uniprot ID |
Q9NUI1 |
Protein Name |
Peroxisomal 2,4-dienoyl-CoA reductase |
Sample Type Confirmation |
DECR2 is supported by BioGPS gene expression data to be expressed in Jurkat |
Protein Accession # |
NP_065715 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_020664 |
Tested Species Reactivity |
Human |
Gene Symbol |
DECR2 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% |
Image 1 | Human Jurkat
| WB Suggested Anti-DECR2 Antibody Titration: 5.0ug/ml Positive Control: Jurkat cell lysateDECR2 is supported by BioGPS gene expression data to be expressed in Jurkat |
|