DECR2 Antibody - N-terminal region (ARP43566_T100)

Data Sheet
 
Product Number ARP43566_T100
Product Page www.avivasysbio.com/decr2-antibody-n-terminal-region-arp43566-t100.html
Name DECR2 Antibody - N-terminal region (ARP43566_T100)
Protein Size (# AA) 292 amino acids
Molecular Weight 32kDa
NCBI Gene Id 26063
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name 2,4-dienoyl CoA reductase 2, peroxisomal
Alias Symbols PDCR, SDR17C1
Peptide Sequence Synthetic peptide located within the following region: MAQPPPDVEGDDCLPAYRHLFCPDLLRDKVAFITGGGSGIGFRIAEIFMR
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference De (2001) Biochim. Biophys. Acta 1533 (1), 66-72
Description of Target DECR2 is auxiliary enzyme of beta-oxidation. It participates in the degradation of unsaturated fatty enoyl-CoA esters having double bonds in both even- and odd-numbered positions in peroxisome. It catalyzes the NADP-dependent reduction of 2,4-dienoyl-CoA to yield trans-3-enoyl-CoA and has activity towards short and medium chain 2,4-dienoyl-CoAs, but also towards 2,4,7,10,13,16,19-docosaheptaenoyl-CoA, suggesting that it does not constitute a rate limiting step in the peroxisomal degradation of docosahexaenoic acid.
Protein Interactions PEX5; EP300; UBC; APP; NEDD4L;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-DECR2 (ARP43566_T100) antibody
Blocking Peptide For anti-DECR2 (ARP43566_T100) antibody is Catalog # AAP43566 (Previous Catalog # AAPP25011)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human DECR2
Uniprot ID Q9NUI1
Protein Name Peroxisomal 2,4-dienoyl-CoA reductase
Sample Type Confirmation

DECR2 is supported by BioGPS gene expression data to be expressed in Jurkat

Protein Accession # NP_065715
Purification Protein A purified
Nucleotide Accession # NM_020664
Tested Species Reactivity Human
Gene Symbol DECR2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Image 1
Human Jurkat
WB Suggested Anti-DECR2 Antibody Titration: 5.0ug/ml
Positive Control: Jurkat cell lysateDECR2 is supported by BioGPS gene expression data to be expressed in Jurkat
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com