STEAP3 Antibody - N-terminal region (ARP43536_T100)

Data Sheet
 
Product Number ARP43536_T100
Product Page www.avivasysbio.com/steap3-antibody-n-terminal-region-arp43536-t100.html
Name STEAP3 Antibody - N-terminal region (ARP43536_T100)
Protein Size (# AA) 488 amino acids
Molecular Weight 54kDa
NCBI Gene Id 55240
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name STEAP family member 3, metalloreductase
Alias Symbols STMP3, TSAP6, pHyde, AHMIO2, dudlin-2, dudulin-2
Peptide Sequence Synthetic peptide located within the following region: LVGSGFKVVVGSRNPKRTARLFPSAAQVTFQEEAVSSPEVIFVAVFREHY
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Amzallag,N., (2004) J. Biol. Chem. 279 (44), 46104-46112
Description of Target AS an endosomal ferrireductase, STEAP3 is required for efficient transferrin-dependent iron uptake in erythroid cells. It participates in erythroid iron homeostasis by reducing Fe(3+) to Fe(2+) and can also reduce of Cu(2+) to Cu(1+), suggesting that it participates in copper homeostasis. STEAP3 uses NAD(+) as acceptor (By similarity). It may play a role downstream of p53/TP53 to interface apoptosis and cell cycle progression. STEAP3 is indirectly involved in exosome secretion by facilitating the secretion of proteins such as TCT
Protein Interactions UBC; SETD7; BAD; TPT1; BNIP3L; PKMYT1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-STEAP3 (ARP43536_T100) antibody
Blocking Peptide For anti-STEAP3 (ARP43536_T100) antibody is Catalog # AAP43536 (Previous Catalog # AAPS15803)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human STEAP3
Uniprot ID Q658P3
Protein Name Metalloreductase STEAP3
Protein Accession # NP_001008410
Purification Protein A purified
Nucleotide Accession # NM_001008410
Tested Species Reactivity Human
Gene Symbol STEAP3
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 79%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 92%; Rabbit: 93%; Rat: 100%
Image 1
Human HepG2
WB Suggested Anti-STEAP3 Antibody Titration: 5.0ug/ml
Positive Control: HepG2 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com