Product Number |
ARP43536_T100 |
Product Page |
www.avivasysbio.com/steap3-antibody-n-terminal-region-arp43536-t100.html |
Name |
STEAP3 Antibody - N-terminal region (ARP43536_T100) |
Protein Size (# AA) |
488 amino acids |
Molecular Weight |
54kDa |
NCBI Gene Id |
55240 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
STEAP family member 3, metalloreductase |
Alias Symbols |
STMP3, TSAP6, pHyde, AHMIO2, dudlin-2, dudulin-2 |
Peptide Sequence |
Synthetic peptide located within the following region: LVGSGFKVVVGSRNPKRTARLFPSAAQVTFQEEAVSSPEVIFVAVFREHY |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Amzallag,N., (2004) J. Biol. Chem. 279 (44), 46104-46112 |
Description of Target |
AS an endosomal ferrireductase, STEAP3 is required for efficient transferrin-dependent iron uptake in erythroid cells. It participates in erythroid iron homeostasis by reducing Fe(3+) to Fe(2+) and can also reduce of Cu(2+) to Cu(1+), suggesting that it participates in copper homeostasis. STEAP3 uses NAD(+) as acceptor (By similarity). It may play a role downstream of p53/TP53 to interface apoptosis and cell cycle progression. STEAP3 is indirectly involved in exosome secretion by facilitating the secretion of proteins such as TCT |
Protein Interactions |
UBC; SETD7; BAD; TPT1; BNIP3L; PKMYT1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-STEAP3 (ARP43536_T100) antibody |
Blocking Peptide |
For anti-STEAP3 (ARP43536_T100) antibody is Catalog # AAP43536 (Previous Catalog # AAPS15803) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human STEAP3 |
Uniprot ID |
Q658P3 |
Protein Name |
Metalloreductase STEAP3 |
Protein Accession # |
NP_001008410 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_001008410 |
Tested Species Reactivity |
Human |
Gene Symbol |
STEAP3 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 79%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 92%; Rabbit: 93%; Rat: 100% |
Image 1 | Human HepG2
| WB Suggested Anti-STEAP3 Antibody Titration: 5.0ug/ml Positive Control: HepG2 cell lysate |
|