M6PR Antibody - N-terminal region (ARP43519_T100)

Data Sheet
 
Product Number ARP43519_T100
Product Page www.avivasysbio.com/m6pr-antibody-n-terminal-region-arp43519-t100.html
Name M6PR Antibody - N-terminal region (ARP43519_T100)
Protein Size (# AA) 277 amino acids
Molecular Weight 28kDa
NCBI Gene Id 4074
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Mannose-6-phosphate receptor (cation dependent)
Alias Symbols SMPR, MPR46, CD-MPR, MPR 46, MPR-46, CD-M6PR
Peptide Sequence Synthetic peptide located within the following region: RLKPLFNKSFESTVGQGSDTYIYIFRVCREAGNHTSGAGLVQINKSNGKE
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Chen,J.J., (2004) Cell 119 (7), 915-926
Description of Target M6PR is a receptor for mannose-6-phosphate groups on lysosomal enzymes. The receptor forms a homodimer or homotetramer for intracellular targeting of lysosomal enzymes and export of newly synthesized lysosomal enzymes into the cell secretions. The receptor is an integral membrane protein which localizes to the trans-Golgi reticulum, endosomes, and the plasma membrane.The protein encoded by this gene is a receptor for mannose-6-phosphate groups on lysosomal enzymes. The receptor forms a homodimer or homotetramer for intracellular targeting of lysosomal enzymes and export of newly synthesized lysosomal enzymes into the cell secretions. The receptor is an integral membrane protein which localizes to the trans-Golgi reticulum, endosomes, and the plasma membrane.
Protein Interactions FBXO6; ATP4A; SNRPGP15; HPDL; RPS28; RPL37A; RPL6; RANBP2; NDUFS4; NDUFB4; ACP2; ACOX1; GGA3; GGA1; JUN; UBC; GGA2; PLIN3; REN;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-M6PR (ARP43519_T100) antibody
Blocking Peptide For anti-M6PR (ARP43519_T100) antibody is Catalog # AAP43519 (Previous Catalog # AAPS15712)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human M6PR
Uniprot ID P20645
Protein Name Cation-dependent mannose-6-phosphate receptor
Protein Accession # NP_002346
Purification Protein A purified
Nucleotide Accession # NM_002355
Tested Species Reactivity Human
Gene Symbol M6PR
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 85%; Dog: 86%; Guinea Pig: 100%; Horse: 86%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Image 1
Human Jurkat
WB Suggested Anti-M6PR Antibody Titration: 5.0ug/ml
Positive Control: Jurkat cell lysate
Image 2
Human , Mouse
Human, Mouse
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com