GOT2 Antibody - C-terminal region (ARP43518_T100)

Data Sheet
 
Product Number ARP43518_T100
Product Page www.avivasysbio.com/got2-antibody-c-terminal-region-arp43518-t100.html
Name GOT2 Antibody - C-terminal region (ARP43518_T100)
Protein Size (# AA) 430 amino acids
Molecular Weight 45kDa
NCBI Gene Id 2806
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Glutamic-oxaloacetic transaminase 2, mitochondrial (aspartate aminotransferase 2)
Description
Alias Symbols KAT4, DEE82, KATIV, KYAT4, mitAAT
Peptide Sequence Synthetic peptide located within the following region: AILNTPDLRKQWLQEVKVMADRIIGMRTQLVSNLKKEGSTHNWQHITDQI
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Suzuki,Y., Gene 200 (1-2), 149-156 (1997)
Description of Target Glutamic-oxaloacetic transaminase is a pyridoxal phosphate-dependent enzyme which exists in cytoplasmic and inner-membrane mitochondrial forms, GOT1 and GOT2, respectively. GOT plays a role in amino acid metabolism and the urea and tricarboxylic acid cycles. The two enzymes are homodimeric and show close homology.Glutamic-oxaloacetic transaminase is a pyridoxal phosphate-dependent enzyme which exists in cytoplasmic and inner-membrane mitochondrial forms, GOT1 and GOT2, respectively. GOT plays a role in amino acid metabolism and the urea and tricarboxylic acid cycles. The two enzymes are homodimeric and show close homology.
Protein Interactions FUS; UBC; NEDD8; MDM2; CDK2; CCL21; GLRX; GAPDH; APCS; AI837181; HDAC5; PSMD4; THOC7; ZDHHC6; GLUD1; HSPA8; PC; MDH2; CTNNBIP1; MPG;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-GOT2 (ARP43518_T100) antibody
Blocking Peptide For anti-GOT2 (ARP43518_T100) antibody is Catalog # AAP43518 (Previous Catalog # AAPS15711)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human GOT2
Uniprot ID P00505
Protein Name Aspartate aminotransferase, mitochondrial
Publications

Vitamin C and E Treatment Blocks Changes in Kynurenine Metabolism Triggered by Three Weeks of Sprint Interval Training in Recreationally Active Elderly Humans. Antioxidants (Basel). 10 (2021). 34573075

Sample Type Confirmation

GOT2 is supported by BioGPS gene expression data to be expressed in HepG2

Protein Accession # NP_002071
Purification Protein A purified
Nucleotide Accession # NM_002080
Tested Species Reactivity Human
Gene Symbol GOT2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Image 1
Human HepG2
WB Suggested Anti-GOT2 Antibody Titration: 1.25ug/ml
Positive Control: HepG2 cell lysateGOT2 is supported by BioGPS gene expression data to be expressed in HepG2
Image 2
Human Liver
Human Liver
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com