RNF175 Antibody - middle region (ARP43458_T100)

Data Sheet
 
Product Number ARP43458_T100
Product Page www.avivasysbio.com/rnf175-antibody-middle-region-arp43458-t100.html
Name RNF175 Antibody - middle region (ARP43458_T100)
Protein Size (# AA) 181 amino acids
Molecular Weight 19kDa
NCBI Gene Id 285533
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Ring finger protein 175
Alias Symbols FLJ34190
Peptide Sequence Synthetic peptide located within the following region: YGLYYGVMGRDFAEICSDYMASTIGFYSVSRLPTRSLSDNICAVCGQKII
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target The function remains unknown.
Protein Interactions KRTAP10-3; KRTAP10-7;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-RNF175 (ARP43458_T100) antibody
Blocking Peptide For anti-RNF175 (ARP43458_T100) antibody is Catalog # AAP43458 (Previous Catalog # AAPS15303)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human RNF175
Uniprot ID Q8NB61
Protein Name RING finger protein 175 Ensembl ENSP00000274068
Protein Accession # EAX04951
Purification Protein A purified
Nucleotide Accession # NM_173662
Tested Species Reactivity Human
Gene Symbol RNF175
Predicted Species Reactivity Human
Application WB
Predicted Homology Based on Immunogen Sequence Human: 100%
Image 1
Human HepG2
WB Suggested Anti-RNF175 Antibody Titration: 1.25ug/ml
Positive Control: HepG2 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com