Product Number |
ARP43458_T100 |
Product Page |
www.avivasysbio.com/rnf175-antibody-middle-region-arp43458-t100.html |
Name |
RNF175 Antibody - middle region (ARP43458_T100) |
Protein Size (# AA) |
181 amino acids |
Molecular Weight |
19kDa |
NCBI Gene Id |
285533 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Ring finger protein 175 |
Alias Symbols |
FLJ34190 |
Peptide Sequence |
Synthetic peptide located within the following region: YGLYYGVMGRDFAEICSDYMASTIGFYSVSRLPTRSLSDNICAVCGQKII |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
The function remains unknown. |
Protein Interactions |
KRTAP10-3; KRTAP10-7; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-RNF175 (ARP43458_T100) antibody |
Blocking Peptide |
For anti-RNF175 (ARP43458_T100) antibody is Catalog # AAP43458 (Previous Catalog # AAPS15303) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human RNF175 |
Uniprot ID |
Q8NB61 |
Protein Name |
RING finger protein 175 Ensembl ENSP00000274068 |
Protein Accession # |
EAX04951 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_173662 |
Tested Species Reactivity |
Human |
Gene Symbol |
RNF175 |
Predicted Species Reactivity |
Human |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Human: 100% |
Image 1 | Human HepG2
| WB Suggested Anti-RNF175 Antibody Titration: 1.25ug/ml Positive Control: HepG2 cell lysate |
|
|