TRIM59 Antibody - middle region (ARP43451_T100)

• Product Number: ARP43451_T100
• Name: TRIM59 Antibody - middle region (ARP43451_T100)
• Protein Size (# AA): 403 amino acids
• Molecular Weight: 44kDa
• NCBI Gene Id: 286827
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Tripartite motif containing 59
• Alias Symbols: MRF1, TSBF1, IFT80L, RNF104, TRIM57
• Peptide Sequence: Synthetic peptide located within the following region: LEKVDDVRQHVQILKQRPLPEVQPVEIYPRVSKILKEEWSRTEIGQIKNV
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Chang,R., Gene 291 (1-2), 241-249 (2002)
• Description of Target: The function remains unknown.
• Protein Interactions: ZDHHC22; NRM; VTI1B; TP53; ECSIT; UBC; ESR2; ESR1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-TRIM59 (ARP43451_T100) antibody is Catalog # AAP43451 (Previous Catalog # AAPP25230)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TRIM59
• Uniprot ID: Q8IWR1
• Protein Name: Tripartite motif-containing protein 59
• Protein Accession #: NP_775107
• Purification: Protein A purified
• Nucleotide Accession #: NM_173084
• Tested Species Reactivity: Human
• Gene Symbol: TRIM59
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 86%; Rat: 100%
• Image 1: Human Jurkat
  
  WB Suggested Anti-TRIM59 Antibody Titration: 5.0ug/ml
  Positive Control: Jurkat cell lysate
• Image 2: Human kidney
  
  Human kidney