Product Number |
ARP43450_P050 |
Product Page |
www.avivasysbio.com/trim59-antibody-n-terminal-region-arp43450-p050.html |
Name |
TRIM59 Antibody - N-terminal region (ARP43450_P050) |
Protein Size (# AA) |
403 amino acids |
Molecular Weight |
44kDa |
NCBI Gene Id |
286827 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Tripartite motif containing 59 |
Alias Symbols |
MRF1, TSBF1, IFT80L, RNF104, TRIM57 |
Peptide Sequence |
Synthetic peptide located within the following region: RIPLKCPNCRSITEIAPTGIESLPVNFALRAIIEKYQQEDHPDIVTCPEH |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Chang,R., Gene 291 (1-2), 241-249 (2002) |
Description of Target |
The function remains unknown. |
Protein Interactions |
ZDHHC22; NRM; VTI1B; TP53; ECSIT; UBC; ESR2; ESR1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-TRIM59 (ARP43450_P050) antibody |
Blocking Peptide |
For anti-TRIM59 (ARP43450_P050) antibody is Catalog # AAP43450 (Previous Catalog # AAPP25229) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human TRIM59 |
Uniprot ID |
Q8IWR1 |
Protein Name |
Tripartite motif-containing protein 59 |
Protein Accession # |
NP_775107 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_173084 |
Tested Species Reactivity |
Human |
Gene Symbol |
TRIM59 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 93% |
Image 1 | Human Jurkat
| WB Suggested Anti-TRIM59 Antibody Titration: 0.2-1 ug/ml Positive Control: Jurkat cell lysate |
|