| Product Number |
ARP43447_T100 |
| Product Page |
www.avivasysbio.com/rnf39-antibody-c-terminal-region-arp43447-t100.html |
| Name |
RNF39 Antibody - C-terminal region (ARP43447_T100) |
| Protein Size (# AA) |
251 amino acids |
| Molecular Weight |
28kDa |
| NCBI Gene Id |
80352 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Ring finger protein 39 |
| Alias Symbols |
HZF, HZFW, LIRF, FAP216 |
| Peptide Sequence |
Synthetic peptide located within the following region: CRSINSNPHFRPKIMRPHLVSTFPRPCSKPNPFLPSGSQNLLSPTATTVL |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Matsuo,R., (2001) Biochem. Biophys. Res. Commun. 289 (2), 479-484 |
| Description of Target |
Its gene lies within the major histocompatibility complex class I region on chromosome 6. Studies of a similar rat protein suggest that RNF39 plays a role in an early phase of synaptic plasticity. Its gene lies within the major histocompatibility complex class I region on chromosome 6.This gene lies within the major histocompatibility complex class I region on chromosome 6. Studies of a similar rat protein suggest that this gene encodes a protein that plays a role in an early phase of synaptic plasticity. Alternative splicing results in three transcript variants encoding different isoforms.This gene lies within the major histocompatibility complex class I region on chromosome 6. Studies of a similar rat protein suggest that this gene encodes a protein that plays a role in an early phase of synaptic plasticity. Alternative splicing results in three transcript variants encoding different isoforms. |
| Protein Interactions |
UBC; TP53; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-RNF39 (ARP43447_T100) antibody |
| Blocking Peptide |
For anti-RNF39 (ARP43447_T100) antibody is Catalog # AAP43447 (Previous Catalog # AAPS15211) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human RNF39 |
| Uniprot ID |
A6NCD6 |
| Protein Name |
RING finger protein 39 |
| Protein Accession # |
NP_739576 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_170770 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
RNF39 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100% |
| Image 1 | Human HepG2
 | WB Suggested Anti-RNF39 Antibody Titration: 2.5ug/ml
Positive Control: HepG2 cell lysate |
|
|
