PEX10 Antibody - middle region (ARP43442_P050)

Data Sheet
 
Product Number ARP43442_P050
Product Page www.avivasysbio.com/pex10-antibody-middle-region-arp43442-p050.html
Name PEX10 Antibody - middle region (ARP43442_P050)
Protein Size (# AA) 346 amino acids
Molecular Weight 39kDa
NCBI Gene Id 5192
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Peroxisomal biogenesis factor 10
Alias Symbols NALD, PBD6A, PBD6B, RNF69
Peptide Sequence Synthetic peptide located within the following region: QALRPDPLRVLMSVAPSALQLRVRSLPGEDLRARVSYRLLGVISLLHLVL
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Gregory,S.G., (2006) Nature 441 (7091), 315-321
Description of Target PEX10 is a protein involved in import of peroxisomal matrix proteins. This protein localizes to the peroxisomal membrane. Mutations in PEX10 gene result in phenotypes within the Zellweger spectrum of peroxisomal biogenesis disorders, ranging from neonatal adrenoleukodystrophy to Zellweger syndrome.This gene encodes a protein involved in import of peroxisomal matrix proteins. This protein localizes to the peroxisomal membrane. Mutations in this gene result in phenotypes within the Zellweger spectrum of peroxisomal biogenesis disorders, ranging from neonatal adrenoleukodystrophy to Zellweger syndrome. Alternative splicing results in two transcript variants encoding different isoforms.
Protein Interactions HNRNPD; PEX5; PEX14; LIG4; PCGF6; CGRRF1; MKRN3; PEX19; PEX12; PEX10; UBC; UBE2I; PEX2;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-PEX10 (ARP43442_P050) antibody
Blocking Peptide For anti-PEX10 (ARP43442_P050) antibody is Catalog # AAP43442 (Previous Catalog # AAPP25223)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human PEX10
Uniprot ID O60683-2
Protein Name Peroxisome biogenesis factor 10
Protein Accession # NP_722540
Purification Affinity Purified
Nucleotide Accession # NM_153818
Tested Species Reactivity Human
Gene Symbol PEX10
Predicted Species Reactivity Human
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Human: 100%
Image 1
Transfected 293T
WB Suggested Anti-PEX10 Antibody Titration: 0.2-1 ug/ml
Positive Control: Transfected 293T
Image 2
Human Muscle
Human Muscle
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com