| Product Number |
ARP43421_P050 |
| Product Page |
www.avivasysbio.com/dcst1-antibody-c-terminal-region-arp43421-p050.html |
| Name |
DCST1 Antibody - C-terminal region (ARP43421_P050) |
| Protein Size (# AA) |
706 amino acids |
| Molecular Weight |
81 kDa |
| NCBI Gene Id |
149095 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
DC-STAMP domain containing 1 |
| Alias Symbols |
FLJ32785, RP11-307C12.10 |
| Peptide Sequence |
Synthetic peptide located within the following region: SYVCRTLDCEAVYCWSCWDDMRQRCPVCTPREELSSSAFSDSNDDTAYAG |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Isogai,T., Unpublished (2001) |
| Description of Target |
The function remains unknown. |
| Protein Interactions |
NEDD1; CUL4A; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Enhanced Validation |
| Relative Expression (Western Blot) |
 |
|
| Datasheets/Manuals |
Printable datasheet for anti-DCST1 (ARP43421_P050) antibody |
| Blocking Peptide |
For anti-DCST1 (ARP43421_P050) antibody is Catalog # AAP43421 (Previous Catalog # AAPP25204) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human DCST1 |
| Uniprot ID |
Q5T197 |
| Protein Name |
DC-STAMP domain-containing protein 1 |
| Publications |
Dong, R. et al. Cells with dendritic cell morphology and immunophenotype, binuclear morphology, and immunosuppressive function in dendritic cell cultures. Cell. Immunol. 272, 1-10 (2011). 22030471 |
| Protein Accession # |
NP_689707 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_152494 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
DCST1 |
| Predicted Species Reactivity |
Human, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 79%; Dog: 79%; Guinea Pig: 93%; Horse: 79%; Human: 100%; Rabbit: 93%; Rat: 85% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-DCST1 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate |
|
| Image 2 | Human Heart
 | Immunohistochemistry with Human Heart lysate tissue at an antibody concentration of 5.0ug/ml using anti-DCST1 antibody (ARP43421_P050) |
|
| Image 3 | Western Blot
 | 25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. Canonical isoform is 81 kDa and can be glycosylated. Also recognizes a potential ~58 kDa isoform. |
|
