| Product Number |
ARP43419_P050 |
| Product Page |
www.avivasysbio.com/rnf165-antibody-middle-region-arp43419-p050.html |
| Name |
RNF165 Antibody - middle region (ARP43419_P050) |
| Protein Size (# AA) |
346 amino acids |
| Molecular Weight |
38kDa |
| NCBI Gene Id |
494470 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Ring finger protein 165 |
| Alias Symbols |
ARKL2, Ark2C, RNF111L2 |
| Peptide Sequence |
Synthetic peptide located within the following region: SSTQMVVHEIRNYPYPQLHFLALQGLNPSRHTSAVRESYEELLQLEDRLG |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Ota,T., (2004) Nat. Genet. 36 (1), 40-45 |
| Description of Target |
RNF165 is encoded in regions involved in pericentric inversions in patients with bipolar affective disorder.Encoded in regions involved in pericentric inversions in patients with bipolar affective disorder. |
| Protein Interactions |
UBE2W; UBE2D4; UBE2E3; UBE2N; UBE2E1; UBE2D3; UBE2D2; UBE2D1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-RNF165 (ARP43419_P050) antibody |
| Blocking Peptide |
For anti-RNF165 (ARP43419_P050) antibody is Catalog # AAP43419 (Previous Catalog # AAPP25202) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human RNF165 |
| Uniprot ID |
Q6ZSG1 |
| Protein Name |
RING finger protein 165 |
| Protein Accession # |
NP_689683 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_152470 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
RNF165 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92% |
| Image 1 | Human kidney
 | Human kidney |
| | Image 2 | Human Jurkat
 | WB Suggested Anti-RNF165 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate |
| | Image 3 | Human Lung, Respiratory Epithelium
 | Rabbit Anti-RNF165 antibody
Catalog Number: ARP43419
Formalin Fixed Paraffin Embedded Tissue: Human Lung, Respiratory Epithelium
Primary antibody Concentration: 1:100
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20x
Exposure Time: 0.5-2.0sec
|
|
|
