| Product Number |
ARP43407_T100 |
| Product Page |
www.avivasysbio.com/nsmce1-antibody-n-terminal-region-arp43407-t100.html |
| Name |
NSMCE1 Antibody - N-terminal region (ARP43407_T100) |
| Protein Size (# AA) |
256 amino acids |
| Molecular Weight |
28kDa |
| NCBI Gene Id |
197370 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Non-SMC element 1 homolog (S. cerevisiae) |
| Alias Symbols |
NSE1 |
| Peptide Sequence |
Synthetic peptide located within the following region: RPIYALVNLATTSISKMATDFAENELDLFRKALELIIDSETGFASSTNIL |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Fujioka,Y., (2002) J. Biol. Chem. 277 (24), 21585-21591 |
| Description of Target |
NSMCE1 is a probable component of the SMC5-SMC6 complex, a complex involved in DNA double-strand breaks by homologous recombination. The complex may promote sister chromatid homologous recombination by recruiting the SMC1-SMC3 cohesin complex to double-strand breaks. |
| Protein Interactions |
UBC; EID3; SMC6; NDNL2; Ube2k; UBE2D2; NSMCE2; NSMCE1; NSMCE4A; SMC5; SUMO2; MAGEF1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-NSMCE1 (ARP43407_T100) antibody |
| Blocking Peptide |
For anti-NSMCE1 (ARP43407_T100) antibody is Catalog # AAP43407 (Previous Catalog # AAPP11486) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human NSMCE1 |
| Uniprot ID |
Q8WV22 |
| Protein Name |
Non-structural maintenance of chromosomes element 1 homolog |
| Protein Accession # |
NP_659547 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_145080 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
NSMCE1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 93%; Goat: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79% |
| Image 1 | Human HepG2
 | WB Suggested Anti-NSMCE1 Antibody Titration: 2.5ug/ml
Positive Control: HepG2 cell lysate |
|
