UBE2J2 Antibody - C-terminal region (ARP43383_T100)

Data Sheet
 
Product Number ARP43383_T100
Product Page www.avivasysbio.com/ube2j2-antibody-c-terminal-region-arp43383-t100.html
Name UBE2J2 Antibody - C-terminal region (ARP43383_T100)
Protein Size (# AA) 275 amino acids
Molecular Weight 30kDa
NCBI Gene Id 118424
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Ubiquitin-conjugating enzyme E2, J2
Alias Symbols NCUBE2, NCUBE-2, PRO2121
Peptide Sequence Synthetic peptide located within the following region: GIQLLNGHAPGAVPNLAGLQQANRHHGLLGGALANLFVIVGFAAFAYTVK
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Otsuki,T., (2005) DNA Res. 12 (2), 117-126
Description of Target The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. UBE2J2 is a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is located in the membrane of the endoplasmic reticulum.The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is located in the membrane of the endoplasmic reticulum. Multiple alternatively spliced transcript variants have been found for this gene, but the full-length nature of some variants has not been defined.
Protein Interactions UBE2J2; UBC; ITCH; HERC4; ATP13A2; NEDD4L; WWP2; PARK2; MGRN1; RNF10; TRIM25; XIAP; UBE2G2;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-UBE2J2 (ARP43383_T100) antibody
Blocking Peptide For anti-UBE2J2 (ARP43383_T100) antibody is Catalog # AAP43383 (Previous Catalog # AAPP11462)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human UBE2J2
Uniprot ID Q8N2K1
Protein Name Ubiquitin-conjugating enzyme E2 J2
Protein Accession # NP_919296
Purification Protein A purified
Nucleotide Accession # NM_194315
Tested Species Reactivity Human
Gene Symbol UBE2J2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 86%
Image 1
Human HepG2
WB Suggested Anti-UBE2J2 Antibody Titration: 1.25ug/ml
Positive Control: HepG2 cell lysate
Image 2
Human Intestine
Human Intestine
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com