Product Number |
ARP43383_T100 |
Product Page |
www.avivasysbio.com/ube2j2-antibody-c-terminal-region-arp43383-t100.html |
Name |
UBE2J2 Antibody - C-terminal region (ARP43383_T100) |
Protein Size (# AA) |
275 amino acids |
Molecular Weight |
30kDa |
NCBI Gene Id |
118424 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Ubiquitin-conjugating enzyme E2, J2 |
Alias Symbols |
NCUBE2, NCUBE-2, PRO2121 |
Peptide Sequence |
Synthetic peptide located within the following region: GIQLLNGHAPGAVPNLAGLQQANRHHGLLGGALANLFVIVGFAAFAYTVK |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Otsuki,T., (2005) DNA Res. 12 (2), 117-126 |
Description of Target |
The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. UBE2J2 is a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is located in the membrane of the endoplasmic reticulum.The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is located in the membrane of the endoplasmic reticulum. Multiple alternatively spliced transcript variants have been found for this gene, but the full-length nature of some variants has not been defined. |
Protein Interactions |
UBE2J2; UBC; ITCH; HERC4; ATP13A2; NEDD4L; WWP2; PARK2; MGRN1; RNF10; TRIM25; XIAP; UBE2G2; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-UBE2J2 (ARP43383_T100) antibody |
Blocking Peptide |
For anti-UBE2J2 (ARP43383_T100) antibody is Catalog # AAP43383 (Previous Catalog # AAPP11462) |
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human UBE2J2 |
Uniprot ID |
Q8N2K1 |
Protein Name |
Ubiquitin-conjugating enzyme E2 J2 |
Protein Accession # |
NP_919296 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_194315 |
Tested Species Reactivity |
Human |
Gene Symbol |
UBE2J2 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 86% |
Image 1 | Human HepG2
| WB Suggested Anti-UBE2J2 Antibody Titration: 1.25ug/ml Positive Control: HepG2 cell lysate |
|
Image 2 | Human Intestine
| Human Intestine |
|