RNF39 Antibody - N-terminal region (ARP43332_P050)

Data Sheet
 
Product Number ARP43332_P050
Product Page www.avivasysbio.com/rnf39-antibody-n-terminal-region-arp43332-p050.html
Name RNF39 Antibody - N-terminal region (ARP43332_P050)
Protein Size (# AA) 354 amino acids
Molecular Weight 39kDa
NCBI Gene Id 80352
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Ring finger protein 39
Alias Symbols HZF, HZFW, LIRF, FAP216
Peptide Sequence Synthetic peptide located within the following region: EGRKAAKVNAGVGEKGIYTASSRGGPPSARSKAVTVVAEGAASRSWLSMD
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Matsuo,R., (2001) Biochem. Biophys. Res. Commun. 289 (2), 479-484
Description of Target Its gene lies within the major histocompatibility complex class I region on chromosome 6. Studies of a similar rat protein suggest that RNF39 plays a role in an early phase of synaptic plasticity. Its gene lies within the major histocompatibility complex class I region on chromosome 6.This gene lies within the major histocompatibility complex class I region on chromosome 6. Studies of a similar rat protein suggest that this gene encodes a protein that plays a role in an early phase of synaptic plasticity. Alternative splicing results in three transcript variants encoding different isoforms.
Protein Interactions UBC; TP53;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-RNF39 (ARP43332_P050) antibody
Blocking Peptide For anti-RNF39 (ARP43332_P050) antibody is Catalog # AAP43332 (Previous Catalog # AAPP11411)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human RNF39
Uniprot ID A2BEK3
Protein Name RING finger protein 39
Protein Accession # NP_739575
Purification Affinity Purified
Nucleotide Accession # NM_170769
Tested Species Reactivity Human
Gene Symbol RNF39
Predicted Species Reactivity Human, Horse
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Horse: 92%; Human: 100%
Image 1
Human Jurkat
WB Suggested Anti-RNF39 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate
Image 2
Human Intestine
Human Intestine
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com