RNF38 Antibody - N-terminal region (ARP43304_T100)

Data Sheet
 
Product Number ARP43304_T100
Product Page www.avivasysbio.com/rnf38-antibody-n-terminal-region-arp43304-t100.html
Name RNF38 Antibody - N-terminal region (ARP43304_T100)
Protein Size (# AA) 465 amino acids
Molecular Weight 51kDa
NCBI Gene Id 152006
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Ring finger protein 38
Alias Symbols FLJ21343
Peptide Sequence Synthetic peptide located within the following region: FDYTSASPAPSPPMRPWEMTSNRQPPSVRPSQHHFSGERCNTPARNRRSP
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Kimura,K., (2006) Genome Res. 16 (1), 55-65
Description of Target RNF38 is a protein with a coiled-coil motif and a RING-H2 motif (C3H2C2) at its carboxy-terminus. The RING motif is a zinc-binding domain found in a large set of proteins playing roles in diverse cellular processes including oncogenesis, development, signal transduction, and apoptosis.This gene encodes a protein with a coiled-coil motif and a RING-H2 motif (C3H2C2) at its carboxy-terminus. The RING motif is a zinc-binding domain found in a large set of proteins playing roles in diverse cellular processes including oncogenesis, development, signal transduction, and apoptosis. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Protein Interactions RNF38; UBE2D2; TP53; DTX3; UBC; RNF114; DZIP3; LDB1; ELAVL1; UBE2D4; TP63; UBE2H; UBE2D3; UBE2D1; TP73;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-RNF38 (ARP43304_T100) antibody
Blocking Peptide For anti-RNF38 (ARP43304_T100) antibody is Catalog # AAP43304 (Previous Catalog # AAPP11379)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human RNF38
Uniprot ID A6PVQ0
Sample Type Confirmation

RNF38 is supported by BioGPS gene expression data to be expressed in Jurkat

Protein Accession # NP_919310
Purification Protein A purified
Nucleotide Accession # NM_194329
Tested Species Reactivity Human
Gene Symbol RNF38
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 93%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 100%
Image 1
Human Jurkat
WB Suggested Anti-RNF38 Antibody Titration: 5.0ug/ml
Positive Control: Jurkat cell lysateRNF38 is supported by BioGPS gene expression data to be expressed in Jurkat
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com