Product Number |
ARP43304_T100 |
Product Page |
www.avivasysbio.com/rnf38-antibody-n-terminal-region-arp43304-t100.html |
Name |
RNF38 Antibody - N-terminal region (ARP43304_T100) |
Protein Size (# AA) |
465 amino acids |
Molecular Weight |
51kDa |
NCBI Gene Id |
152006 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Ring finger protein 38 |
Alias Symbols |
FLJ21343 |
Peptide Sequence |
Synthetic peptide located within the following region: FDYTSASPAPSPPMRPWEMTSNRQPPSVRPSQHHFSGERCNTPARNRRSP |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Kimura,K., (2006) Genome Res. 16 (1), 55-65 |
Description of Target |
RNF38 is a protein with a coiled-coil motif and a RING-H2 motif (C3H2C2) at its carboxy-terminus. The RING motif is a zinc-binding domain found in a large set of proteins playing roles in diverse cellular processes including oncogenesis, development, signal transduction, and apoptosis.This gene encodes a protein with a coiled-coil motif and a RING-H2 motif (C3H2C2) at its carboxy-terminus. The RING motif is a zinc-binding domain found in a large set of proteins playing roles in diverse cellular processes including oncogenesis, development, signal transduction, and apoptosis. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. |
Protein Interactions |
RNF38; UBE2D2; TP53; DTX3; UBC; RNF114; DZIP3; LDB1; ELAVL1; UBE2D4; TP63; UBE2H; UBE2D3; UBE2D1; TP73; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-RNF38 (ARP43304_T100) antibody |
Blocking Peptide |
For anti-RNF38 (ARP43304_T100) antibody is Catalog # AAP43304 (Previous Catalog # AAPP11379) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human RNF38 |
Uniprot ID |
A6PVQ0 |
Sample Type Confirmation |
RNF38 is supported by BioGPS gene expression data to be expressed in Jurkat |
Protein Accession # |
NP_919310 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_194329 |
Tested Species Reactivity |
Human |
Gene Symbol |
RNF38 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 93%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 100% |
Image 1 | Human Jurkat
| WB Suggested Anti-RNF38 Antibody Titration: 5.0ug/ml Positive Control: Jurkat cell lysateRNF38 is supported by BioGPS gene expression data to be expressed in Jurkat |
|
|