| Product Number |
ARP43257_P050 |
| Product Page |
www.avivasysbio.com/trim36-antibody-n-terminal-region-arp43257-p050.html |
| Name |
Trim36 Antibody - N-terminal region (ARP43257_P050) |
| Protein Size (# AA) |
729 amino acids |
| Molecular Weight |
83kDa |
| NCBI Gene Id |
291597 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Tripartite motif-containing 36 |
| Alias Symbols |
Trim36 |
| Peptide Sequence |
Synthetic peptide located within the following region: ESTKSCMDCSASYCNECFKIYHPWGTVKAQHEYVGPTTNFRPKILMCPEH |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
E3 ubiquitin-protein ligase which mediates ubiquitination and subsequent proteasomal degradation of target proteins. Trim36 is involved in chromosome segregation and cell cycle regulation. It may play a role in the acrosome reaction and fertilization. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Trim36 (ARP43257_P050) antibody |
| Blocking Peptide |
For anti-Trim36 (ARP43257_P050) antibody is Catalog # AAP43257 (Previous Catalog # AAPP11332) |
| Protein Accession # |
NP_001099617 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001106147 |
| Tested Species Reactivity |
Rat |
| Gene Symbol |
Trim36 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% |
| Image 1 | Rat Lung
 | WB Suggested Anti-Trim36 Antibody
Titration: 1.0 ug/ml
Positive Control: Rat lung |
|
|
