RNF121 Antibody - N-terminal region (ARP43252_T100)

• Product Number: ARP43252_T100
• Name: RNF121 Antibody - N-terminal region (ARP43252_T100)
• Protein Size (# AA): 295 amino acids
• Molecular Weight: 38 kDa
• NCBI Gene Id: 55298
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Ring finger protein 121
• Alias Symbols: FLJ11099
• Peptide Sequence: Synthetic peptide located within the following region: WWRFLVIWILFSAVTAFVTFRATRKPLVQTTPRLVYKWFLLIYKISYATG
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: The protein contains a RING finger, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions.The protein encoded by this gene contains a RING finger, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions. Multiple alternatively spliced transcript variants encoding distinct isoforms have been reported. Three of them are supported by at least two independent transcripts or ESTs, the full length natures of others are not clear.
• Protein Interactions: UBC;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation: Relative Expression (Western Blot)
  
• Blocking Peptide: For anti-RNF121 (ARP43252_T100) antibody is Catalog # AAP43252 (Previous Catalog # AAPP11327)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RNF121
• Uniprot ID: Q9H920
• Sample Type Confirmation:

  RNF121 is supported by BioGPS gene expression data to be expressed in HepG2

• Protein Accession #: NP_919435
• Purification: Protein A purified
• Nucleotide Accession #: NM_194453
• Tested Species Reactivity: Human
• Gene Symbol: RNF121
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
• Image 1: Human Intestine
  
  Human Intestine
• Image 2: Western Blot
  
  25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. Immunogen sequence is present in the canonical 38 kDa protein, as well as 35 kDa, 32 kDa, and 28 kDa forms.