C14orf130 antibody - C-terminal region (ARP43243_T100)
Data Sheet
Product Number ARP43243_T100
Product Page www.avivasysbio.com/c14orf130-antibody-c-terminal-region-arp43243-t100.html
Product Name C14orf130 antibody - C-terminal region (ARP43243_T100)
Size 100 ul
Gene Symbol UBR7
Alias Symbols FLJ10483, MGC9518, C14orf130
Protein Size (# AA) 274 amino acids
Molecular Weight 30kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 55148
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name Ubiquitin protein ligase E3 component n-recognin 7 (putative)
Description This is a rabbit polyclonal antibody against C14orf130. It was validated on Western Blot and immunohistochemistry by Aviva Systems Biology. At Aviva Systems Biology we manufacture rabbit polyclonal antibodies on a large scale (200-1000 products/month) of high throughput manner. Our antibodies are peptide based and protein family oriented. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (info@avivasysbio.com).
Peptide Sequence Synthetic peptide located within the following region: DRSDPLMDTLSSMNRVQQVELICEYNDLKTELKDYLKRFADEGTVVKRED
Description of Target The function remains unknown.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Lead Time Domestic: within 1-2 days delivery International: 1-2 days
Blocking Peptide For anti-UBR7 (ARP43243_T100) antibody is Catalog # AAP43243 (Previous Catalog # AAPP11318)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human C14orf130
Complete computational species homology data Anti-C14orf130 (ARP43243_T100)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express C14orf130.
Swissprot Id Q8N806
Protein Name Putative E3 ubiquitin-protein ligase UBR7
Sample Type Confirmation

UBR7 is supported by BioGPS gene expression data to be expressed in Jurkat

Protein Accession # AAH15046
Purification Protein A purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express C14orf130.
Nucleotide Accession # NM_175748
Replacement Item This antibody may replace item sc-101977 from Santa Cruz Biotechnology.
Conjugation Options

ARP43243_T100-FITC Conjugated

ARP43243_T100-HRP Conjugated

ARP43243_T100-Biotin Conjugated

CB Replacement sc-101977; sc-154876
Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Image 1
Human kidney
Human kidney
Image 2
Human Jurkat
WB Suggested Anti-C14orf130 Antibody Titration: 1.25ug/ml
Positive Control: Jurkat cell lysate

UBR7 is supported by BioGPS gene expression data to be expressed in Jurkat


AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com