| Product Number |
ARP43169_P050 |
| Product Page |
www.avivasysbio.com/anapc10-antibody-n-terminal-region-arp43169-p050.html |
| Name |
ANAPC10 Antibody - N-terminal region (ARP43169_P050) |
| Protein Size (# AA) |
185 amino acids |
| Molecular Weight |
21kDa |
| Subunit |
10 |
| NCBI Gene Id |
10393 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Anaphase promoting complex subunit 10 |
| Alias Symbols |
DOC1, APC10 |
| Peptide Sequence |
Synthetic peptide located within the following region: MTTPNKTPPGADPKQLERTGTVREIGSQAVWSLSSCKPGFGVDQLRDDNL |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Nourry,C., (er) BMC Cell Biol. 5, 20 (2004) |
| Description of Target |
ANAPC10 is a component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle. The APC/C complex acts by mediating ubiquitination and sub |
| Protein Interactions |
ANAPC4; DCPS; UBC; ANAPC15; MDC1; TP53BP1; LIG4; ANAPC1; ANAPC7; ANAPC2; CDC16; CDC23; CDC27; Gm9174; Cdc20; Bub1b; PPP2R1A; APC2; ANAPC11; SMAD3; SMAD2; LRP1; LRP8; LRP2; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ANAPC10 (ARP43169_P050) antibody |
| Blocking Peptide |
For anti-ANAPC10 (ARP43169_P050) antibody is Catalog # AAP43169 (Previous Catalog # AAPP25138) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ANAPC10 |
| Uniprot ID |
Q9UM13 |
| Protein Name |
Anaphase-promoting complex subunit 10 |
| Protein Accession # |
NP_055700 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_014885 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ANAPC10 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85% |
| Image 1 | Human Spleen
 | WB Suggested Anti-ANAPC10 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Spleen |
|
