PRPF19 Antibody - N-terminal region (ARP43157_T100)

Data Sheet
 
Product Number ARP43157_T100
Product Page www.avivasysbio.com/prpf19-antibody-n-terminal-region-arp43157-t100.html
Name PRPF19 Antibody - N-terminal region (ARP43157_T100)
Protein Size (# AA) 504 amino acids
Molecular Weight 55kDa
NCBI Gene Id 27339
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae)
Alias Symbols PSO4, SNEV, PRP19, UBOX4, hPSO4, NMP200
Peptide Sequence Synthetic peptide located within the following region: VPEHPCVSPVSNHVYERRLIEKYIAENGTDPINNQPLSEEQLIDIKVAHP
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Voglauer,R., (2006) Exp. Cell Res. 312 (6), 746-759
Description of Target PRPF19 plays a role in DNA double-strand break (DSB) repair and pre-mRNA splicing reaction. It binds double-stranded DNA in a sequence-nonspecific manner. PRPF19 acts as a structural component of the nuclear framework. It may also serve as a support for spliceosome binding and activity. It is essential for spliceosome assembly in a oligomerization-dependent manner and might also be important for spliceosome stability. It also may have E3 ubiquitin ligase activity. The PSO4 complex is required in the DNA interstrand cross-links (ICLs) repair process. Overexpression of PRPF19 might extend the cellular life span by increasing the resistance to stress or by improving the DNA repair capacity of the cells.In S. cerevisiae, Pso4 has pleiotropic functions in DNA recombination and in error-prone nonhomologous end-joining DNA repair.[supplied by OMIM].
Protein Interactions HUWE1; USP4; UBE2D3; SUMO2; CEP76; CEP250; TUBGCP3; CEP57; VCP; UBC; SUMO1; NEDD8; LIN28A; EXOC7; EXOC3; RPA3; RPA2; RPA1; RNF2; SUZ12; EED; rev; MEPCE; SEC13; PARK2; TARDBP; UBD; CSNK2A2; UCHL5; WHSC1; U2AF1; PRCC; HSP90AA1; HSPB1; FN1; RBM10; vif; CDC40
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-PRPF19 (ARP43157_T100) antibody
Blocking Peptide For anti-PRPF19 (ARP43157_T100) antibody is Catalog # AAP43157 (Previous Catalog # AAPP25127)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human PRPF19
Uniprot ID Q9UMS4
Protein Name Pre-mRNA-processing factor 19
Sample Type Confirmation

PRPF19 is supported by BioGPS gene expression data to be expressed in HepG2

Protein Accession # NP_055317
Purification Protein A purified
Nucleotide Accession # NM_014502
Tested Species Reactivity Human
Gene Symbol PRPF19
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 83%; Zebrafish: 86%
Image 1
Human HepG2
WB Suggested Anti-PRPF19 Antibody Titration: 1.25ug/ml
Positive Control: HepG2 cell lysatePRPF19 is supported by BioGPS gene expression data to be expressed in HepG2
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com