| Product Number |
ARP43142_T100 |
| Product Page |
www.avivasysbio.com/mkrn1-antibody-c-terminal-region-arp43142-t100.html |
| Name |
MKRN1 Antibody - C-terminal region (ARP43142_T100) |
| Protein Size (# AA) |
339 amino acids |
| Molecular Weight |
37kDa |
| NCBI Gene Id |
23608 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Makorin ring finger protein 1 |
| Alias Symbols |
RNF61 |
| Peptide Sequence |
Synthetic peptide located within the following region: RYFDEGRGSCPFGGNCFYKHAYPDGRREEPQRQKVGTSSRYRAQRRNHFW |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The Makorin ring finger protein-1 (MKRN1) is a novel class of zinc finger proteins. Phylogenetic analyses indicate that the MKRN1 gene is the ancestral founder of this gene family. |
| Protein Interactions |
UBC; TP53; CDKN1A; FADD; MAP1LC3B; UBE2W; DUSP23; CSNK1G1; UBE2D3; TERT; EXOSC8; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-MKRN1 (ARP43142_T100) antibody |
| Blocking Peptide |
For anti-MKRN1 (ARP43142_T100) antibody is Catalog # AAP43142 (Previous Catalog # AAPP25114) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human MKRN1 |
| Uniprot ID |
Q9UHC7 |
| Protein Name |
E3 ubiquitin-protein ligase makorin-1 |
| Protein Accession # |
EAW83951 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_001145125 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
MKRN1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-MKRN1 Antibody Titration: 1.25ug/ml
Positive Control: Jurkat cell lysate |
|
|
