Product Number |
ARP43141_T100 |
Product Page |
www.avivasysbio.com/mkrn1-antibody-n-terminal-region-arp43141-t100.html |
Name |
MKRN1 Antibody - N-terminal region (ARP43141_T100) |
Protein Size (# AA) |
147 amino acids |
Molecular Weight |
16kDa |
NCBI Gene Id |
23608 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Makorin ring finger protein 1 |
Alias Symbols |
RNF61 |
Peptide Sequence |
Synthetic peptide located within the following region: GDRCRYEHSKPLKQEEATATELTTKSSLAASSSLSSIVGPLVEMNTGEAE |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Knutson,M., (2004) J. Neurosci. Res. 76 (5), 633-641 |
Description of Target |
The Makorin ring finger protein-1 gene (MKRN1) is a highly transcribed, intron-containing source for a family of intronless mammalian genes encoding a novel class of zinc finger proteins. Phylogenetic analyses indicate that the MKRN1 gene is the ancestral founder of this gene family.The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is closely related to a stimulator of iron transport (SFT), and is up-regulated in hereditary hemochromatosis. It also functions in the ubiquitination of the tumor-suppressor protein p53 and the hypoxia-inducible transcription factor HIF1alpha by interacting with the E1 ubiquitin-activating enzyme and the E3 ubiquitin-protein ligases. |
Protein Interactions |
UBC; TP53; CDKN1A; FADD; MAP1LC3B; UBE2W; DUSP23; CSNK1G1; UBE2D3; TERT; EXOSC8; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-MKRN1 (ARP43141_T100) antibody |
Blocking Peptide |
For anti-MKRN1 (ARP43141_T100) antibody is Catalog # AAP43006 (Previous Catalog # AAPP11217) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human MKRN1 |
Uniprot ID |
Q9UHC7 |
Protein Name |
E3 ubiquitin-protein ligase makorin-1 |
Protein Accession # |
NP_038474 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_003338 |
Tested Species Reactivity |
Human |
Gene Symbol |
MKRN1 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 83%; Rat: 100%; Zebrafish: 77% |
Image 1 | Human Jurkat
| WB Suggested Anti-MKRN1 Antibody Titration: 1.25ug/ml Positive Control: Jurkat cell lysate |
|