MKRN1 Antibody - N-terminal region (ARP43141_T100)

Data Sheet
 
Product Number ARP43141_T100
Product Page www.avivasysbio.com/mkrn1-antibody-n-terminal-region-arp43141-t100.html
Name MKRN1 Antibody - N-terminal region (ARP43141_T100)
Protein Size (# AA) 147 amino acids
Molecular Weight 16kDa
NCBI Gene Id 23608
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Makorin ring finger protein 1
Alias Symbols RNF61
Peptide Sequence Synthetic peptide located within the following region: GDRCRYEHSKPLKQEEATATELTTKSSLAASSSLSSIVGPLVEMNTGEAE
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Knutson,M., (2004) J. Neurosci. Res. 76 (5), 633-641
Description of Target The Makorin ring finger protein-1 gene (MKRN1) is a highly transcribed, intron-containing source for a family of intronless mammalian genes encoding a novel class of zinc finger proteins. Phylogenetic analyses indicate that the MKRN1 gene is the ancestral founder of this gene family.The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is closely related to a stimulator of iron transport (SFT), and is up-regulated in hereditary hemochromatosis. It also functions in the ubiquitination of the tumor-suppressor protein p53 and the hypoxia-inducible transcription factor HIF1alpha by interacting with the E1 ubiquitin-activating enzyme and the E3 ubiquitin-protein ligases.
Protein Interactions UBC; TP53; CDKN1A; FADD; MAP1LC3B; UBE2W; DUSP23; CSNK1G1; UBE2D3; TERT; EXOSC8;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-MKRN1 (ARP43141_T100) antibody
Blocking Peptide For anti-MKRN1 (ARP43141_T100) antibody is Catalog # AAP43006 (Previous Catalog # AAPP11217)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human MKRN1
Uniprot ID Q9UHC7
Protein Name E3 ubiquitin-protein ligase makorin-1
Protein Accession # NP_038474
Purification Protein A purified
Nucleotide Accession # NM_003338
Tested Species Reactivity Human
Gene Symbol MKRN1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 83%; Rat: 100%; Zebrafish: 77%
Image 1
Human Jurkat
WB Suggested Anti-MKRN1 Antibody Titration: 1.25ug/ml
Positive Control: Jurkat cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com