FBXL7 Antibody - N-terminal region (ARP43132_T100)

• Product Number: ARP43132_T100
• Name: FBXL7 Antibody - N-terminal region (ARP43132_T100)
• Protein Size (# AA): 491 amino acids
• Molecular Weight: 54kDa
• NCBI Gene Id: 23194
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: F-box and leucine-rich repeat protein 7
• Alias Symbols: FBL6, FBL7
• Peptide Sequence: Synthetic peptide located within the following region: IRLASRPQKEQASIDRLPDHSMVQIFSFLPTNQLCRCARVCRRWYNLAWD
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Venables,J.P., (2005) Hum. Mol. Genet. 14 (16), 2289-2303
• Description of Target: FBXL7 is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein belongs to the Fbls class and, in addition to an F-box, contains several tandem leucine-rich repeats.This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbls class and, in addition to an F-box, contains several tandem leucine-rich repeats.
• Protein Interactions: WDR48; AHCYL1; ZRANB2; APP; SKP1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-FBXL7 (ARP43132_T100) antibody is Catalog # AAP43132 (Previous Catalog # AAPP25105)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FBXL7
• Uniprot ID: Q9UJT9
• Protein Name: F-box/LRR-repeat protein 7
• Protein Accession #: NP_036436
• Purification: Protein A purified
• Nucleotide Accession #: NM_012304
• Tested Species Reactivity: Human
• Gene Symbol: FBXL7
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Guinea Pig, Horse, Rabbit
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 92%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 92%; Rat: 100%
• Image 1: Ovary tumor, HepG2
  
  Host: Rabbit
  Target: FBXL7
  Positive control (+): Ovary tumor (T-OV)
  Negative control (-): HepG2 (HG)
  Antibody concentration: 1ug/ml
• Image 2: Human kidney
  
  Human kidney
• Image 3: Human Fetal Liver
  
  Host: Rabbit
  Target Name: FBXL7
  Sample Tissue: Human Fetal Liver
  Antibody Dilution: 1.0ug/ml