FBXO3 Antibody - N-terminal region (ARP43119_P050)

• Product Number: ARP43119_P050
• Name: FBXO3 Antibody - N-terminal region (ARP43119_P050)
• Protein Size (# AA): 415 amino acids
• Molecular Weight: 47kDa
• NCBI Gene Id: 26273
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: F-box protein 3
• Alias Symbols: FBA, FBX3
• Peptide Sequence: Synthetic peptide located within the following region: NCCYVSRRLSQLSSHDPLWRRHCKKYWLISEEEKTQKNQCWKSLFIDTYS
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Ilyin,G.P., (2000) Genomics 67 (1), 40-47
• Description of Target: FBXO3 is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. FBXO3 belongs to the Fbxs class. Alternative splicing of this gene generates 2 transcript variants diverging at the 3' end. This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbxs class. Alternative splicing of this gene generates 2 transcript variants diverging at the 3' end.
• Protein Interactions: DCP2; tat; UBC; HSP90AA1; UBD; HIPK2; COPS5; RBX1; CUL1; CUL3; SKP1; PML; NEDD8; EP300; TNFAIP3;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-FBXO3 (ARP43119_P050) antibody is Catalog # AAP43119 (Previous Catalog # AAPP25088)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FBXO3
• Uniprot ID: Q9UK99
• Protein Name: F-box only protein 3
• Protein Accession #: NP_208385
• Purification: Affinity Purified
• Nucleotide Accession #: NM_033406
• Tested Species Reactivity: Human
• Gene Symbol: FBXO3
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%
• Image 1: Human Small Intestine
  
  WB Suggested Anti-FBXO3 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:62500
  Positive Control: Human Small Intestine
• Image 2: Human Fetal Lung
  
  Host: Rabbit
  Target Name: NSUN6
  Sample Type: Human Fetal Lung
  Antibody Dilution: 1.0ug/ml
• Image 3: Human Fetal Liver
  
  Host: Rabbit
  Target Name: FAM46C
  Sample Type: Human Fetal Liver
  Antibody Dilution: 1.0ug/ml
• Image 4: Human Adult Placenta
  
  Host: Rabbit
  Target Name: SERPINA3
  Sample Type: Human Adult Placenta
  Antibody Dilution: 1.0ug/ml
• Image 5: Human Fetal Heart
  
  Host: Rabbit
  Target Name: GNAS
  Sample Type: Human Fetal Heart
  Antibody Dilution: 1.0ug/ml