FBXO24 Antibody - middle region (ARP43116_P050)

• Product Number: ARP43116_P050
• Name: FBXO24 Antibody - middle region (ARP43116_P050)
• Protein Size (# AA): 318 amino acids
• Molecular Weight: 36kDa
• NCBI Gene Id: 26261
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: F-box protein 24
• Alias Symbols: FBX24
• Peptide Sequence: Synthetic peptide located within the following region: EGKIYSLVVNETQLDQPRSYTVQLALRKVSHYLPHLRVACMTSNQSSTLY
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Winston,J.T., (1999) Curr. Biol. 9 (20), 1180-1182
• Description of Target: FBXO24 is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein belongs to the Fbxs class. Alternative splicing of this gene generates two transcript variants.This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbxs class. Alternative splicing of this gene generates two transcript variants.
• Protein Interactions: HSP90AA1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-FBXO24 (ARP43116_P050) antibody is Catalog # AAP43116 (Previous Catalog # AAPP25085)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FBXO24
• Uniprot ID: O75426
• Protein Name: F-box only protein 24
• Protein Accession #: NP_036304
• Purification: Affinity Purified
• Nucleotide Accession #: NM_012172
• Tested Species Reactivity: Human
• Gene Symbol: FBXO24
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
• Image 1: Human MCF-7
  
  WB Suggested Anti-FBXO24 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:312500
  Positive Control: MCF7 cell lysate