THOC4 Antibody - N-terminal region (ARP43055_T100)

Data Sheet
 
Product Number ARP43055_T100
Product Page www.avivasysbio.com/thoc4-antibody-n-terminal-region-arp43055-t100.html
Name THOC4 Antibody - N-terminal region (ARP43055_T100)
Protein Size (# AA) 257 amino acids
Molecular Weight 28kDa
Subunit 4
NCBI Gene Id 10189
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Aly/REF export factor
Alias Symbols ALY, BEF, REF, THOC4, ALY/REF
Peptide Sequence Synthetic peptide located within the following region: GGGPIRNRPAIARGAAGGGGRNRPAPYSRPKQLPDKWQHDLFDSGFGGGA
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Strasser,K., (2002) Nature 417 (6886), 304-308
Description of Target THOC4 is a heat stable, nuclear protein and functions as a molecular chaperone. It is thought to regulate dimerization, DNA binding, and transcriptional activity of basic region-leucine zipper (bZIP) proteins.The protein encoded by this gene is a heat stable, nuclear protein and functions as a molecular chaperone. It is thought to regulate dimerization, DNA binding, and transcriptional activity of basic region-leucine zipper (bZIP) proteins.
Protein Interactions TP53; AKT1; NEDD1; THOC3; NCBP1; THOC2; CEP250; THOC5; DDX39B; STAU1; UBC; MDM2; SUZ12; EED; RNF2; FBXO6; CD81; ICAM1; IGSF8; PAN2; VCAM1; ITGA4; IL7R; FN1; CBX8; EIF4A3; MAGOH; PAXIP1; TRIP12; TRIP13; UBE2I; SF3B4; TLE3; YBX1; HNRNPM; ERCC4; ATP6V1E1; UB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ALYREF (ARP43055_T100) antibody
Blocking Peptide For anti-ALYREF (ARP43055_T100) antibody is Catalog # AAP43055 (Previous Catalog # AAPP25032)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human THOC4
Uniprot ID Q86V81
Protein Name THO complex subunit 4
Publications

Ding, D., Enriquez-Algeciras, M., Dave, K. R., Perez-Pinzon, M. & Bhattacharya, S. K. The role of deimination in ATP5b mRNA transport in a transgenic mouse model of multiple sclerosis. EMBO Rep. 13, 230-6 (2012). 22261716

Protein Accession # NP_005773
Purification Protein A purified
Nucleotide Accession # NM_005782
Tested Species Reactivity Human
Gene Symbol ALYREF
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Zebrafish
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 100%
Image 1
Human Lung
Human Lung
Image 2
Human HepG2
WB Suggested Anti-THOC4 Antibody Titration: 2.5ug/ml
Positive Control: HepG2 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com