website statistics
Product Datasheet: ARP43045_P050 - RAPSN antibody - N-terminal region (ARP43045_P050) - Aviva Systems Biology
 
RAPSN antibody - N-terminal region (ARP43045_P050)
Data Sheet
 
Product Number ARP43045_P050
Product Page www.avivasysbio.com/rapsn-antibody-n-terminal-region-arp43045-p050.html
Product Name RAPSN antibody - N-terminal region (ARP43045_P050)
Size 100 ul
Gene Symbol RAPSN
Alias Symbols CMS1D, CMS1E, MGC3597, RAPSYN, RNF205
Protein Size (# AA) 353 amino acids
Molecular Weight 39kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 5913
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name Receptor-associated protein of the synapse
Description This is a rabbit polyclonal antibody against RAPSN. It was validated on Western Blot using a cell lysate as a positive control. Aviva Systems Biology strives to provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (info@avivasysbio.com).
Peptide Sequence Synthetic peptide located within the following region: MGQDQTKQQIEKGLQLYQSNQTEKALQVWTKVLEKSSDLMGRFRVLGCLV
Target Reference Muller,J.S., (2004) Neuromuscul. Disord. 14 (11), 744-749
Description of Target RAPSN belongs to a family of proteins that are receptor associated proteins of the synapse. It contains a conserved cAMP-dependent protein kinase phosphorylation site. It is believed to play some role in anchoring or stabilizing the nicotinic acetylcholine receptor at synaptic sites. It may link the receptor to the underlying postsynaptic cytoskeleton, possibly by direct association with actin or spectrin.This protein belongs to a family of proteins that are receptor associated proteins of the synapse. It contains a conserved cAMP-dependent protein kinase phosphorylation site. It is believed to play some role in anchoring or stabilizing the nicotinic acetylcholine receptor at synaptic sites. It may link the receptor to the underlying postsynaptic cytoskeleton, possibly by direct association with actin or spectrin. Two splice variants have been identified for this gene.
Protein Interactions BAG3; HSP90AA1; UBE2Z; KHDRBS1; MUSK; CHRNB1; DAG1; GRB2;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Lead Time Domestic: within 1-2 days delivery International: 1-2 days
Blocking Peptide For anti-RAPSN (ARP43045_P050) antibody is Catalog # AAP43045 (Previous Catalog # AAPP25025)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human RAPSN
Complete computational species homology data Anti-RAPSN (ARP43045_P050)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express RAPSN.
Swissprot Id Q13702-2
Protein Name 43 kDa receptor-associated protein of the synapse
Protein Accession # NP_116034
Purification Affinity Purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express RAPSN.
Nucleotide Accession # NM_032645
Conjugation Options

ARP43045_P050-FITC Conjugated

ARP43045_P050-HRP Conjugated

ARP43045_P050-Biotin Conjugated

CB Tag neuroscience
Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Image 1
Human Jurkat
WB Suggested Anti-RAPSN Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com