UBE2D1 Antibody - middle region (ARP43006_T100)

Data Sheet
 
Product Number ARP43006_T100
Product Page www.avivasysbio.com/ube2d1-antibody-middle-region-arp43006-t100.html
Name UBE2D1 Antibody - middle region (ARP43006_T100)
Protein Size (# AA) 147 amino acids
Molecular Weight 16kDa
NCBI Gene Id 7321
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Ubiquitin-conjugating enzyme E2D 1
Alias Symbols SFT, UBCH5, UBC4/5, UBCH5A, E2(17)KB1
Peptide Sequence Synthetic peptide located within the following region: SQWSPALTVSKVLLSICSLLCDPNPDDPLVPDIAQIYKSDKEKYNRHARE
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. UBE2D1 is a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is closely related to a stimulator of iron transport (SFT), and is up-regulated in hereditary hemochromatosis. It also functions in the ubiquitination of the tumor-suppressor protein p53 and the hypoxia-inducible transcription factor HIF1alpha by interacting with the E1 ubiquitin-activating enzyme and the E3 ubiquitin-protein ligases.
Protein Interactions RBX1; STUB1; RNF7; RNF14; MID1; MDM2; EP300; CREBBP; ANAPC11; DTL; RNF115; MKRN2; NEDD4L; FAF2; TRIM32; MID2; RNF111; RNF5; RSP5; GPB1; NHLRC1; RFFL; UHRF2; DTX2; ZNRF1; TRIM63; RNF146; FBXO31; RNF26; TRIM39; RNF126; FBXW7; NEDD4; CUL1; CUL3; MKRN3; UBE3A
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-UBE2D1 (ARP43006_T100) antibody
Blocking Peptide For anti-UBE2D1 (ARP43006_T100) antibody is Catalog # AAP42661 (Previous Catalog # AAPP24891)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human UBE2D1
Uniprot ID P51668
Protein Name Ubiquitin-conjugating enzyme E2 D1
Protein Accession # NP_003329
Purification Protein A purified
Nucleotide Accession # NM_001204880
Tested Species Reactivity Human, Rat
Gene Symbol UBE2D1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Pig, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 79%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 93%
Image 1
Rat Skeletal Muscle
Host: Rat
Target Name: UBE2D1
Sample Tissue: Rat Skeletal Muscle
Antibody Dilution: 1ug/ml
Image 2
recombinant protein
Lanes:
1: 40ng HIS-UBE2D1 protein
2: 40ng HIS-UBE2D2 protein
3: 40ng HIS-UBE2D3 protein
4: 40ng HIS-UBE2D4 protein
5: 40ng HIS-UBE2E1 protein
6: 40ng HIS-UBE2E2 protein
7: 40ng HIS-UBE2E3 protein
8: 40ng HIS-UBE2K protein
9: 40ng HIS-UBE2L3 protein
10: 40ng HIS-UBE2N protein
11: 40ng HIS-UBE2V1 protein
12: 40ng HIS-UBE2V2 protein.
Primary Antibody Dilution:
1:500
Secondary Antibody:
Anti-rabbit-HRP
Secondary Antibody Dilution:
1:50,000
Gene Name:
UBE2D1
Submitted by:
Dr Chris Boutell. MRC-UoG Centre for Virus Research (CVR), UK.
Image 3
Human Jurkat
WB Suggested Anti-UBE2D1 Antibody Titration: 1.25ug/ml
Positive Control: Jurkat cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com