PEX10 Antibody - C-terminal region (ARP42997_P050)

• Product Number: ARP42997_P050
• Name: PEX10 Antibody - C-terminal region (ARP42997_P050)
• Protein Size (# AA): 326 amino acids
• Molecular Weight: 37kDa
• NCBI Gene Id: 5192
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Peroxisomal biogenesis factor 10
• Alias Symbols: NALD, PBD6A, PBD6B, RNF69
• Peptide Sequence: Synthetic peptide located within the following region: ERRHPTATPCGHLFCWECITAWCSSKAECPLCREKFPPQKLIYLRHYR
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Gregory,S.G., (2006) Nature 441 (7091), 315-321
• Description of Target: PEX10 is a protein involved in import of peroxisomal matrix proteins. This protein localizes to the peroxisomal membrane. Mutations in PEX10 gene result in phenotypes within the Zellweger spectrum of peroxisomal biogenesis disorders, ranging from neonatal adrenoleukodystrophy to Zellweger syndrome.This gene encodes a protein involved in import of peroxisomal matrix proteins. This protein localizes to the peroxisomal membrane. Mutations in this gene result in phenotypes within the Zellweger spectrum of peroxisomal biogenesis disorders, ranging from neonatal adrenoleukodystrophy to Zellweger syndrome. Alternative splicing results in two transcript variants encoding different isoforms.
• Protein Interactions: HNRNPD; PEX5; PEX14; LIG4; PCGF6; CGRRF1; MKRN3; PEX19; PEX12; PEX10; UBC; UBE2I; PEX2;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-PEX10 (ARP42997_P050) antibody is Catalog # AAP42997 (Previous Catalog # AAPP11208)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human PEX10
• Uniprot ID: O60683
• Protein Name: Peroxisome biogenesis factor 10
• Sample Type Confirmation:

  PEX10 is supported by BioGPS gene expression data to be expressed in MCF7

• Protein Accession #: NP_002608
• Purification: Affinity Purified
• Nucleotide Accession #: NM_002617
• Tested Species Reactivity: Human
• Gene Symbol: PEX10
• Predicted Species Reactivity: Human, Mouse, Rat, Dog, Guinea Pig, Horse
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rat: 93%
• Image 1: Human MCF-7
  
  WB Suggested Anti-PEX10 Antibody Titration: 0.2-1 ug/ml
  Positive Control: MCF7 cell lysatePEX10 is supported by BioGPS gene expression data to be expressed in MCF7