| Product Number |
ARP42935_T100 |
| Product Page |
www.avivasysbio.com/mgc33926-antibody-middle-region-arp42935-t100.html |
| Name |
MGC33926 Antibody - middle region (ARP42935_T100) |
| Protein Size (# AA) |
297 amino acids |
| Molecular Weight |
33kDa |
| NCBI Gene Id |
130733 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Transmembrane protein 178 |
| Alias Symbols |
TMEM178 |
| Peptide Sequence |
Synthetic peptide located within the following region: RLRNIPFNLTKTIQQDEWHLLHLRRITAGFLGMAVAVLLCGCIVATVSFF |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Otsuki,T., (2005) DNA Res. 12 (2), 117-126 |
| Description of Target |
The function remains unknown. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-TMEM178A (ARP42935_T100) antibody |
| Blocking Peptide |
For anti-TMEM178A (ARP42935_T100) antibody is Catalog # AAP42935 (Previous Catalog # AAPS13110) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human MGC33926 |
| Uniprot ID |
Q8NBL3 |
| Protein Name |
Transmembrane protein 178A |
| Protein Accession # |
NP_689603 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_152390 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
TMEM178A |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86% |
| Image 1 | Human HepG2
 | WB Suggested Anti-MGC33926 Antibody Titration: 1.25ug/ml
Positive Control: HepG2 cell lysate |
|
|
