Product Number |
ARP42927_P050 |
Product Page |
www.avivasysbio.com/amotl1-antibody-n-terminal-region-arp42927-p050.html |
Name |
AMOTL1 Antibody - N-terminal region (ARP42927_P050) |
Protein Size (# AA) |
956 amino acids |
Molecular Weight |
107 kDa |
NCBI Gene Id |
154810 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Angiomotin like 1 |
Alias Symbols |
JEAP |
Peptide Sequence |
Synthetic peptide located within the following region: LTQEDPQMVYQSARQEPQGQEHQVDNTVMEKQVRSTQPQQNNEELPTYEE |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Mehrle,A., Nucleic Acids Res. 34 (DATABASE ISSUE), D415-D418 (2006) |
Description of Target |
AMOTL1 is a peripheral membrane protein that is a component of tight junctions or TJs. TJs form an apical junctional structure and act to control paracellular permeability and maintain cell polarity. This protein is related to angiomotin, an angiostatin binding protein that regulates endothelial cell migration and capillary formation.The protein encoded by this gene is a peripheral membrane protein that is a component of tight junctions or TJs. TJs form an apical junctional structure and act to control paracellular permeability and maintain cell polarity. This protein is related to angiomotin, an angiostatin binding protein that regulates endothelial cell migration and capillary formation. |
Protein Interactions |
WWOX; SUZ12; NEDD4; HECW2; AMOT; LATS2; YAP1; LATS1; Wwtr1; UBC; Magi1; NEDD4L; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Enhanced Validation |
Relative Expression (Western Blot) |
|
|
Datasheets/Manuals |
Printable datasheet for anti-AMOTL1 (ARP42927_P050) antibody |
Blocking Peptide |
For anti-AMOTL1 (ARP42927_P050) antibody is Catalog # AAP42927 (Previous Catalog # AAPS13102) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human AMOTL1 |
Uniprot ID |
Q8IY63 |
Protein Name |
Angiomotin-like protein 1 |
Publications |
Skouloudaki, K. & Walz, G. YAP1 recruits c-Abl to protect angiomotin-like 1 from Nedd4-mediated degradation. PLoS One 7, e35735 (2012). 22558212 |
Protein Accession # |
NP_570899 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_130847 |
Tested Species Reactivity |
Human |
Gene Symbol |
AMOTL1 |
Predicted Species Reactivity |
Human, Mouse, Cow, Dog, Guinea Pig, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 79%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100% |
Image 1 | Human 293T
| WB Suggested Anti-AMOTL1 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: 293T cell lysate |
|
Image 2 |
| 25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. The peptide sequence is contained in a few smaller isoforms of the protein, including isoform 2 at 101 kDa.
|
|