AMOTL1 Antibody - N-terminal region (ARP42927_P050)

Data Sheet
 
Product Number ARP42927_P050
Product Page www.avivasysbio.com/amotl1-antibody-n-terminal-region-arp42927-p050.html
Name AMOTL1 Antibody - N-terminal region (ARP42927_P050)
Protein Size (# AA) 956 amino acids
Molecular Weight 107 kDa
NCBI Gene Id 154810
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Angiomotin like 1
Alias Symbols JEAP
Peptide Sequence Synthetic peptide located within the following region: LTQEDPQMVYQSARQEPQGQEHQVDNTVMEKQVRSTQPQQNNEELPTYEE
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Mehrle,A., Nucleic Acids Res. 34 (DATABASE ISSUE), D415-D418 (2006)
Description of Target AMOTL1 is a peripheral membrane protein that is a component of tight junctions or TJs. TJs form an apical junctional structure and act to control paracellular permeability and maintain cell polarity. This protein is related to angiomotin, an angiostatin binding protein that regulates endothelial cell migration and capillary formation.The protein encoded by this gene is a peripheral membrane protein that is a component of tight junctions or TJs. TJs form an apical junctional structure and act to control paracellular permeability and maintain cell polarity. This protein is related to angiomotin, an angiostatin binding protein that regulates endothelial cell migration and capillary formation.
Protein Interactions WWOX; SUZ12; NEDD4; HECW2; AMOT; LATS2; YAP1; LATS1; Wwtr1; UBC; Magi1; NEDD4L;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Enhanced Validation
Relative Expression (Western Blot) Avivasheild
Datasheets/Manuals Printable datasheet for anti-AMOTL1 (ARP42927_P050) antibody
Blocking Peptide For anti-AMOTL1 (ARP42927_P050) antibody is Catalog # AAP42927 (Previous Catalog # AAPS13102)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human AMOTL1
Uniprot ID Q8IY63
Protein Name Angiomotin-like protein 1
Publications

Skouloudaki, K. & Walz, G. YAP1 recruits c-Abl to protect angiomotin-like 1 from Nedd4-mediated degradation. PLoS One 7, e35735 (2012). 22558212

Protein Accession # NP_570899
Purification Affinity Purified
Nucleotide Accession # NM_130847
Tested Species Reactivity Human
Gene Symbol AMOTL1
Predicted Species Reactivity Human, Mouse, Cow, Dog, Guinea Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 79%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%
Image 1
Human 293T
WB Suggested Anti-AMOTL1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 293T cell lysate
Image 2

25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. The peptide sequence is contained in a few smaller isoforms of the protein, including isoform 2 at 101 kDa.
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com